FIELD OF THE INVENTION

The present invention generally relates to a binding site, termed Site II, in nuclear hormone receptors. The present invention relates to: machine-readable data storage media comprising structure coordinates of Site II; computer systems capableof producing three-dimensional representations of all or any part of Site II; methods used in the design and identification of ligands of Site II and of modulators of nuclear hormone receptors (NHRs); ligands of Site II; modulators of NHRs; methods ofmodulating NHRs; pharmaceutical compositions comprising modulators of NHRs; methods of treating diseases by administering modulators of an NHR; methods of designing mutants; mutant NHRs or portions of mutant NHRs; methods of measuring the binding of atest molecule to Site II; and models of Site II.

BACKGROUND OF THE INVENTION

The nuclear hormone receptor (NHR) family of transcription factors bind low molecular weight ligands and either stimulate or repress transcription. (in The Nuclear Receptor Facts Book, V. Laudet and H. Gronemeyer, Academic Press, p 345, 2002). NHRs stimulate transcription by binding to DNA and inducing transcription of specific genes. NHRs may also stimulate transcription by not binding to DNA itself, rather they may modulate the activity of other DNA binding proteins (Stocklin, E., et al.,Nature (1996) 383:726-8). The process of stimulation of transcription is called transactivation. NHRs repress transcription by interacting with other transcription factors or coactivators and inhibiting the ability of these other transcription factorsor coactivators to induce transcription of specific genes. The process of repression of transcription is called transrepression. (for a review see The Nuclear Receptor Factsbook, V. Laudet and H. Gronemeyer, Academic Press, p 42, 2002). For example,the glucocorticoid receptor, estrogen receptor, androgen receptor and peroxisome proliferator activated receptors .alpha. and .gamma. have been shown to repress the activity of the transcription factors AP-1 and NF-.kappa.B (Jonat, C., et al., Cell,62, p 1189-1204, (1990) Kallio, P. J., et al., Mol. Endocrinol., 9, p 017-1028 (1995), Keller, E. T., et al., J. Biol. Chem., 271, p 26267-26275 (1996), Jones, D. C., et al., J. Biol. Chem., 277 (9), p 6838-6845, (2002), Ricote, M., et al., Nature,391, p 79-82, (1998), Valentine, J. E., et al, J. Biol. Chem., 275, p 25322-25329, (2000).

The nuclear hormone receptor family includes the glucocorticoid receptor (Hollenberg, S. M. et al. (1985) Nature, 318, p 635), progesterone receptor (Misrahi, M. et al. (1987) Biochem. Biophys. Res. Commun. 143, p 740), androgen receptor(Lubahn D. B., et al (1988), estrogen receptors (Green, S., et al. (1986) Nature 320, p 134), mineralocorticoid receptor (Arriza, J. L., et al., (1987) Science 237, p 268), retinoid receptors (RXRs and RARs) (Mangelsdorf, et al. (1990) Nature, 345, p 224and Petkovich M., et al (1987) Nature 330, p 444), Vitamin D receptor, thyroid receptor (TR) (Nakai, A. et al., (1988) Mol. Endocrinol. 2, p 1087), peroxisome proliferator activated receptor (PPAR) (Greene, M. E., et al. (1995) Gene Expression 4, p281), orphan nuclear receptors and others. Glucocorticoid receptor, progesterone receptor, androgen receptor, estrogen receptor, and mineralocorticoid receptor are steroid hormone receptors (SHRs).

Although the sequences vary amongst the various nuclear hormone receptors, they can be divided into functional domains including an N-terminal transactivation domain, a central DNA binding domain and a C-terminal ligand and dimerization domain. The ligands which bind these receptors act in a ligand, cell type, and promoter dependent fashion and include: glucocorticoids, progestins, retinoids, mineralocorticoids, and others. In addition to steroids, recent studies have shown that non-steroidscan bind to nuclear hormone receptors and induce a biologic response (Coghlan, M J, et al, J. Med. Chem. 44, p 2879, 2001). Ligand cross-talk can occur between the receptors, for example, progesterone can bind not only the progesterone receptor but theglucocorticoid receptor as well (Zhang, S., Mol. Endocrinology 10, p 24, 1996).

Three-dimensional structures of some of the nuclear hormone receptors have been elucidated through crystallization or homology modeling. A homology model of the glucocorticoid receptor is disclosed in WO 00/52050, published Sep. 8, 2000.

Recent publications by the same research group: Bledsoe, et. al., Cell, online publication by Cell Press, Jul. 1, 2002, DOI: 10.1016/S0092867402008176; Cell, Vol 110, 93-105, 12 Jul. 2002; and Apolito, et. al., in WO 03/015692 A2, publishedFeb. 27, 2003; describe the successful crystallization and xray structural elucidation of the glucocorticoid receptor LBD as the dimer. X-ray structure coordinates were provided in WO 03/015692. Disruption of the dimeric structure was found to occurupon mutation of selected residues at the dimerization interface. Despite structural similarity to other steroid receptors, the GR LBD dimer represents a unique dimer configuration. The GR LBD used for this crystalization was a mutant (F602S) designedto provide a more soluble LBD construct.

Also recently, Kauppi et. al. published the stucture of the GR LBD bound to an antagonist, RU-486, in: the Journal of Biological Chemistry Online, JBC Papers In Press as DOI:10.1074/JBC.M212711200, Apr. 9, 2003; and in J. Biol. Chem., Vol. 278,Issue 25, 22748-22754, Jun. 20, 2003. In this structure, the GR LBD exhibits a significant displacement of helix 12, typical of antagonist action. In addition to the antagonist-bound LBD, a dimer structure similar to that reported by Bledsoe, et. al.was also described. The structure of the GR LBD-RU-486 complex was deposited in with the RCSB (1nhz.pdb)

Three dimensional structures of other nuclear hormone receptors are disclosed as follows, with RCSB (Research Collaboratory for Structural Bioinformatics, pdb file format) references in parentheses: RXRalpha (1lbd) Bourguet, W., Ruff, M.,Chambon, P., Gronemeyer, H., Moras, D. Nature 375 pp. 377 (1995); PPAR-gamma (2prg) Nolte, R. T., Wisely, G. B., Westin, S., Cobb, J. E., Lambert, M. H., Kurokawa, R., Rosenfeld, M. G., Willson, T. M., Glass, C. K., Milburn, M. V. Nature 395 pp. 137(1998); RARgamma (2lbd) Renaud, J. P., Rochel, N., Ruff, M., Vivat, V., Chambon, P., Gronemeyer, H., Moras, D. Nature 378 pp. 681 (1995); PR (1a28) Williams, S. P., Sigler, P. B. Nature 393 pp. 392 (1998); VitDR (1db1) Rochel, N., Wurtz, J. M.,Mitschler, A., Klaholz, B., Moras, D. Mol. Cell 5 pp. 173 (2000); AR (1e3g) Matias, P. M., Donner, P., Coelho, R., Thomaz, M., Peixoto, C., Macedo, S., Otto, N., Joschko, S., Scholz, P., Wegg, A., Basler, S., Schafer, M., Egner, U., Carrondo, M. A. J.Biol. Chem. 275 pp. 26164 (2000); ERalpha (1a52) Tanenbaum, D. M., Wang, Y., Williams, S. P., Sigler, P. B. Proc Natl Acad Sci USA 95 pp. 5998 (1998); ERbeta (1l2j) Shiau, A. K., Barstad, D., Radek, J. T., Meyers, M. J., Nettles, K. W.,Katzenellenbogen, B. S., Katzenellenbogen, J. A., Agard, D. A., Greene, G. L. Nat. Struct. Biol. 9 pp. 359 (2002). It is generally thought that all steroid ligands bind to nuclear hormone receptors at the classical ligand binding site, which we termsite I (Evans, R. M. Science 240, p 889, 1988). Limited proteolysis studies and cell transfection/mutagenesis studies have delineated the functional domains of nuclear hormone receptors which include a DNA binding domain, ligand binding domain and atransactivation domain. These studies provided the evidence that hormones bind to the ligand binding domain. Mutagenesis of GR has defined the dexamethasone interacting surface, defined as Site I, which includes amino acids Met-560, Met-639, Gln-642and Thr-739 (Lind, U., et al. J. Biol. Chem. 275, p 19041, 2000).

Recently, a second ligand binding site in ER-.alpha. and ER-.beta. has been reported based on computational analysis and docking experiments with steroids. (van Horn, W. J. Med. Chem. 45, p 584, 2002). This second binding site is notcompletely delineated. It is reported to have no obvious function, to be an evolutionary remnant, and to be absent in other nuclear receptors such as RAR.gamma.. Furthermore, there is no discussion of transrepression whatsoever. In addition, EndocrineSociety Meeting June 2003, presentation OR34-1, Wang, Y., Chirgadze, N Y, Briggs, S L, Khan, S., Jensen, E V., Burris, T P., A second binding site for hydroxytamoxifen with the ligand binding domain of estrogen receptor beta, describes the crystalstructure of estrogen receptor bound with 4-hydroxytamoxifen, in which the ligand is found in two locations: the usual steroid binding pocket and a second site located along the hydrophobic groove near the cofactor binding region. This second site isremote from the Site II location described in this application.

The glucocorticoid receptor (GR) is a member of the nuclear hormone receptor family of transcription factors, and a member of the steroid hormone family of transcription factors. Affinity labeling of the glucocorticoid receptor protein allowedthe production of antibodies against the receptor which facilitated cloning the human (Weinberger, et al. Science 228, p 740-742, 1985, Weinberger, et al. Nature, 318, P635-641, 1985) and rat (Miesfeld, R. Nature, 312, p 779-781, 1985) glucocorticoidreceptors. Subsequently, glucocorticoid receptors from other species were cloned including mouse (Danielson, M. et al. EMBO J., 5, 2513), sheep (Yang, K., et al. J. Mol. Endocrinol. 8, p 173-180, 1992), and marmoset (Brandon, D. D., et al, J. Mol.Endocrinol. 7, p 89-96, 1991). There is also a C-terminally distinct isoform of GR termed GR-beta. This isoform is identical to GR up to amino acid 727 and then diverges in the last C-terminal 15 amino acids. GR-beta is not known to bindglucocorticoids, is unable to transactivate, but does bind DNA (Hollenberg, S M. et al. Nature, 318, p 635, 1985, Bamberger, C. M. et al. J. Clin Invest. 95, p 2435, 1995). It is possible that GR-beta binds compounds other than the typicalglucocorticoids.

Glucocorticoids which interact with GR have been used for over 50 years to treat inflammatory diseases. It has been clearly shown that glucocorticoids exert their anti-inflammatory activity via the inhibition by GR of the transcription factorsNF-.kappa.B and AP-1. This inhibition is termed transrepression. It has been shown that the primary mechanism for inhibition of these transcription factors by GR is via a direct physical interaction. This interaction alters the transcription factorcomplex and inhibits the ability of NF-.kappa.B and AP-1 to stimulate transcription (Jonat, C., et al. Cell, 62, p 1189, 1990, Yang-Yen, H. F., et al. Cell 62, p 1205, 1990, Diamond, M. I. et al. Science 249, p 1266, 1990, Caldenhoven, E. et al., Mol.Endocrinol. 9, p 401, 1995). Other mechanisms such as sequestration of co-activators by GR have also been proposed (Kamer Y, et al., Cell 85, p 403, 1996, Chakravarti, D. et al., Nature 383, p 99, 1996). NF-.kappa.B and AP-1 play key roles in theinitiation and perpetuation of inflammatory and immunological disorders (Baldwin, A S, Journal of Clin. Investigation 107, p 3, 2001, Firestein, G. S., and Manning, A. M. Arthritis and Rheumatism, 42, p 609, 1999, Peltz, G., Curr. Opin, in Biotech. 8,p 467, 1997). NF-.kappa.B and AP-1 are involved in regulating the expression of a number of important inflammatory and immunomodulatory genes including: TNF-alpha, IL-1, IL-2, IL-5, adhesion molecules (such as E-selectin), chemokines (such as Eoxtaxinand Rantes), Cox-2, and others.

Although glucocorticoids are very effective anti-inflammatory agents, their systemic use is limited by their side effects which include diabetes, osteoporosis, glaucoma, Cushingoid syndrome, muscle loss, facial swelling, personality changes, andothers. (Stanbury, R M, and Graham, E M, Br. J. Opthalmology 82, p 704, 1998, Da Silva, J A P., Bijlsma, J. Rheumatic Disease Clinics of North America, 26, p 859, 2000)

In addition to leading to transrepression, the interaction of a glucocorticoid with GR can lead to stimulation by GR of transcription of certain genes. This stimulation of transcription is termed transactivation. Transactivation requiresdimerization of GR and binding to a glucocorticoid response element (GRE). DNA binding is mediated via Zn fingers in the DNA binding domain (Giguere, V. et al Cell 46, p 645, 1986; Rusconi, S. and Yamamoto, K. R. EMBO J., 6, p 1309, 1987). DNA sequencespecific interactions are determined by the C-terminal part of the first Zn finger (Danielsen, M., et al. Cell 57, p 1131, 1989). Several GR target genes have been identified including MMTV, metallothionein, and tyrosine amino transferase (Ringold, G Met al, Cell 6, p 299,1975; Scheidereit, C., et al Nature, 304, p 749, 1983; Hager, L J, Palmiter R D, Nature 291, 340, 1981; Grange, T., et al. Oncogene, 20, p 3028, 2001). Transrepression, as opposed to transactivation, can occur in the absence ofdimerization, and as mentioned above is believed to involve the direct interaction of GR with AP-1 and NF-.kappa.B.

Recent studies using a transgenic GR dimerization defective mouse which cannot bind DNA have shown that the transactivation (DNA binding) activities of GR could be separated from the transrepressive (non-DNA binding) effect of GR. These studiesalso indicate that many of the side effects of glucocorticoid therapy are due to the ability of GR to induce transcription of various genes involved in metabolism, whereas, transrepression, which does not require DNA binding leads to suppression ofinflammation. (Tuckermann, J. et al. Cell 93, p 531, 1998; Reichardt, H M. EMBO J., 20, p 7168, 2001).

Compounds which can induce transrepression of GR with none to minimal induction of transactivation have been termed "dissociated steroids" (Vayassiere, B M, et al., Mol. Endocrinology, 11, p 1249, 1997). Such "dissociated" compounds would beuseful to treat inflammatory diseases. See FIG. 1 for a graphical description of transactivation mediated by GR dimers versus transrepression mediated by GR monomers. It is possible that these "dissociated" compounds bind to GR without inducingdimerization yet allow the monomer to transrepress AP-1 and NF-.kappa.B. Another plausible explanation is that "dissociated" compounds may alter the conformation of GR to enable transrepression without inducing a DNA binding conformation.

There are several examples in the literature of compounds that possess dissociated activity as defined by the ratio of the effective concentration required to induce DNA binding in a cellular assay relative to the effective concentration requiredto transrepress, or inhibit AP-1 or NF-.kappa.B activity. The first report of a "dissociated steroid" published by Vayssiere, et al. Molecular Endocrinology, 11, p 1245, 1997, showed that a derivative of dexamethasone had potent in vitro and in vivoanti-inflammatory activity with minimal induction of DNA binding. Subsequent studies (Coghlan, M J, et al., J. Med. Chem. 44, p 4481, 2001) have shown that non-steroidal compounds can bind to GR and elicit transrepressive activity with moderatetransactivation activity. It is believed that each of the compounds described above act via the dexamethasone binding site.

Ursodeoxycholic acid (UDCA) has recently been shown to repress NF-.kappa.B activity via a GR mediated pathway. The compound appears to be "dissociated" as it does not induce DNA binding in a cellular assay. This compound, although acting in aGR dependent fashion, does not compete for dexamethasone binding to GR. Although direct binding of UDCA to GR has not been demonstrated, mutagenesis studies suggest that the ligand binding domain (LBD) of GR is required for activity. (Miura, T., J.Biol. Chem. 276, p 47371, 2001). However, these studies did not delineate the specific amino acids which are involved in UDCA activity.

The art is in need of modulators of NHRs. A modulator of an NHR may be useful in treating NHR-associated diseases, that is diseases associated with the expression products of genes whose transcription is stimulated or repressed by NHRs. Forinstance, the art is in need of modulators of NHR that induce inhibition of AP-1 and NF-.kappa.B, as such modulators would be useful in the treatment of inflammatory and immune associated diseases and disorders, such as osteoarthritis, rheumatoidarthritis, multiple sclerosis, asthma, inflammatory bowel disease, transplant rejection, and graft vs. host disease.

The art is in need of compounds that possess dissociated activity, as such compounds would be useful in treating inflammatory and immune associated diseases and disorders without exhibiting unwanted side effects. For instance, in the case of GR,although glucocorticoids are potent anti-inflammatory agents, their systemic use is limited by side effects. A dissociated compound that retained the anti-inflammatory efficacy of glucocorticoids while minimizing the side effects such as diabetes,osteoporosis and glaucoma would be of great benefit to a very large number of patients with inflammatory diseases.

The art is in need of compounds that antagonize transactivation. For instance, in the case of GR, such compounds may be useful in treating metabolic diseases associated with increased levels of glucocorticoid, such as diabetes, osteoporosis andglaucoma.

The art is in need of compounds that induce transactivation. For instance, in the case of GR, such compounds may be useful in treating metabolic diseases associated with a deficiency in glucocorticoid. Such diseases include Addison's disease.

In order to design compounds that modulate an NHR in specific ways, one needs to understand how ligands bind to an NHR and modulate the activity of the NHR.

SUMMARY OF THE INVENTION

We have identified a second binding site in the ligand binding domain of nuclear hormone receptors (NHRs). We refer to this second binding site as Site II.

Site II is a structure defined by structure coordinates that describe conserved residue backbone atoms having a root mean square deviation of not more than 2.0 .ANG. from the conserved residue backbone atoms described by the structurecoordinates of amino acids E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:13 according to Table I. Table I is located under the heading for Example 21.

FIG. 2 shows the amino acids of Site II in various human NHRs. The structure coordinates of Site II in the NHRs of FIG. 2 are given in Table III, located under the heading for Example 22. Two sets of xray structure coordinates of Site II in GRare given in Table IV, located under the heading for Example 23, and Table V, located under the heading for Example 24. FIG. 6 shows the amino acids of Site II in the GR of various species.

We have found that ligands of Site II modulate NHRs. Ligands of Site II induce transrepression. Ligands of Site II possess dissociated activity. Ligands of Site II antagonize transactivation.

The invention provides machine-readable data storage media comprising data storage material encoded with machine readable data comprising all or any part of the structure coordinates of Site II. The invention provides computer systems comprisingthe machine-readable data storage media of the invention capable of producing three-dimensional representations of all or any part of Site II.

The invention provides methods used in the design and identification of ligands of Site II and modulators of NHRs. The invention provides: methods of docking a test molecule into all or any part of the cavity circumscribed by Site II; methodscomprising identifying structural and chemical features of all or any part of Site II; methods of designing a ligand of Site II comprising modeling all or any part of Site II and designing a chemical entity that has structural and chemicalcomplementarity with all or any part of Site II; methods of evaluating the potential of a chemical entity to bind to all or any part of Site II; methods for identifying a modulator of an NHR; and methods for identifying a ligand of Site II.

The invention provides ligands of Site II. The invention provides modulators of NHRs.

The invention provides methods of modulating an NHR.

The invention provides pharmaceutical compositions comprising modulators of NHRs.

The invention provides methods of treating diseases by administering a modulator of an NHR. Such diseases include NHR-associated diseases, diseases associated with NHR transactivation, diseases associated with NHR transrepression, diseasesassociated with AP-1-dependent gene expression, diseases associated with NF-.kappa.B-dependent gene expression, inflammatory or immune associated diseases and disorders, diseases treatable by inducing NHR transrepression, and diseases treatable byantagonizing NHR transactivation.

The invention provides methods of designing mutants comprising mutating Site II by making an amino acid substitution, deletion or insertion, and the resultant mutant NHRs, or portions of mutant NHRs, comprising a mutation in Site II.

The invention provides methods of measuring the binding of a test molecule to Site II.

The invention provides models of Site II.

All documents referred to herein, including but not limited to U.S. patent applications, are incorporated herein by reference in their entirety.

BRIEF DESCRIPTION OF THE FIGURES

The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.

FIG. 1. Graphical description of transactivation mediated by GR dimers versus transrepression mediated by GR monomers.

FIG. 2. Consensus alignments carried out using ICM (Molsoft LLC, La Jolla, Calif.) between human GR (glucocorticoid receptor) LBD and other human NHR LBDs, indicating by shading the residues of Site II, i.e. residues corresponding to residues ofGR Site II. Dots are spaceholders and do not represent amino acids. Numbers refer to the first residue in each line, are specific for each NHR and are based on the full-length NHR. For the NHRs listed below, with the exception of GR and MR, structuraldata was obtained from the RCSB references listed below, and the numbering system in the RCSB references was used. For GR and MR, structural data was obtained by homology modeling using the literature references below, and the numbering system in thoseliterature references was used. The RCSB references (in parentheses) and literature references for the various NHRs are as follows:

RXRalpha (SEQ ID NO:3) (1lbd) Bourguet, W., Ruff, M., Chambon, P., Gronemeyer, H., Moras, D. Nature 375 pp. 377 (1995); PPAR-gamma (SEQ ID NO:10) (2prg) Nolte, R. T., Wisely, G. B., Westin, S., Cobb, J. E., Lambert, M. H., Kurokawa, R.,Rosenfeld, M. G., Willson, T. M., Glass, C. K., Milburn, M. V. Nature 395 pp. 137 (1998); RARgamma (SEQ ID NO:4) (2lbd) Renaud, J. P., Rochel, N., Ruff, M., Vivat, V., Chambon, P., Gronemeyer, H., Moras, D. Nature 378 pp. 681 (1995); PR (SEQ ID NO:5)(1a28) Williams, S. P., Sigler, P. B. Nature 393 pp. 392 (1998); VitDR (SEQ ID NO:9) (1db1) Rochel, N., Wurtz, J. M., Mitschler, A., Klaholz, B., Moras, D. Mol. Cell 5 pp. 173 (2000); AR (SEQ ID NO:6) (1e3g) Matias, P. M., Donner, P., Coelho, R.,Thomaz, M., Peixoto, C., Macedo, S., Otto, N., Joschko, S., Scholz, P., Wegg, A., Basler, S., Schafer, M., Egner, U., Carrondo, M. A. J. Biol. Chem. 275 pp. 26164 (2000); ERalpha (SEQ ID NO:7) (1a52) Tanenbaum, D. M., Wang, Y., Williams, S. P., Sigler,P. B. Proc Natl Acad Sci USA 95 pp. 5998 (1998); ERbeta (SEQ ID NO:8) (1l2j) Shiau, A. K., Barstad, D., Radek, J. T., Meyers, M. J., Nettles, K. W., Katzenellenbogen, B. S., Katzenellenbogen, J. A., Agard, D. A., Greene, G. L. Nat. Struct. Biol. 9pp. 359 (2002); TRbeta (SEQ ID NO:12) (1bsx) Wagner, R. L., Darimont, B. D., Apriletti, J. W., Stallcup, M. R., Kushner, P. J., Baxter, J. D., Fletterick, R. J., Yamamoto, K. R. Genes Dev. 12 pp. 3343 (1998). MR and GR structural data were obtainedby homology modeling to PR using the sequences from the following references: GR (SEQ ID NO:13), PIR Accession Number QRHUGA, Hollenberg, S. M., Weinberger, C., Ong, E. S., Cerelli, G., Oro, A., Leba, R., Thompson, E. B., Rosenfeld, M. G., Evans, R. M.Nature (1985) 318: 635-641; MR (SEQ ID NO:11), PIR Accession Number A29613, Arriza, J. L.; Weinberger, C., Cerelli, G., Glaser, T. M., Handelin, B. L., Housman, D. E., Evans, R. M., Science (1987) 237: 268-275.

FIG. 3. GR homology model displayed in ribbon format with dexamethasone (green) and Compound 15 (violet) displayed as space-filling models docked in Site I and Site II, respectively. The location of Site I (dexamethasone site) represents theclassical steroid binding site (eg, consistent with the location of progesterone in PR, 1A28). The location of Site II (Compound 15 site) represents the novel binding site which is the subject of this invention.

FIG. 4. Twenty-seven analogues used in the correlation of observed AP-1 inhibition and calculated contact energy scores as derived from docking into the homology model of GR Site II. Compound numbers are given to the left of each compound.

FIG. 5. The relationship between calculated contact energies of a series of twenty-seven analogues of Compound 15 and their % AP-1 inhibition (at 10 .mu.M). Each analogue was modeled as the S-enantiomer and manually positioned in GR Site II ina manner consistent with the orientation depicted in FIG. 3. Energetics were calculated after geometry/energy minimization using Flo (Colin McMartin, Thistlesoft, Colebrook, Conn.).

FIG. 6. Sequence alignments of the GR from various species conducted using the program LOOK (Version 3.5.2, Molecular Applications Group, Palo Alto, Calif.). The sequence for each GR starts at residue 1. Alignments were made based on pair-wisesequence identity. Site II residues are shaded. Dots are spaceholders and do not represent amino acids. Numbers refer to the first residue in each line, are specific for each GR, and are based on the full-length GR. GR sequences were obtained fromthe following sources: Squirrel (SEQ ID NO:14) (Saimiri boliviensis boliviensis) (GenBank U87951) Reynolds, P. D., Pittler, S. J. and Scammell, J. G. J. Clin. Endocrinol. Metab. 82 (2), 465-472 (1997); Pig GR (SEQ ID NO:15) (GenBank AF141371) Gutscher,M., Eder, S., Mueller, M. and Claus, R. Submitted to GenBank (08-APR-1999) Institut fuer Tierhaltung und Tierzuechtung (470), FG Tierhaltung und Leistungsphysiologie, Universitaet Hohenheim, Garbenstr. 17, Stuttgart 70599, Germany; Guinea Pig (SEQ IDNO:16) (GenBank L13196) Keightley, M. C. and Fuller, P. J. Mol. Endocrinol. 8 (4), 431-439 (1994); Marmoset (SEQ ID NO:17) (GenBank U87953) Reynolds, P. D., Pittler, S. J. and Scammell, J. G. J. Clin. Endocrinol. Metab. 82 (2), 465-472 (1997); Ma'zMonkey (SEQ ID NO:18) (GenBank U87952) Reynolds, P. D., Pittler, S. J. and Scammell, J. G. J. Clin. Endocrinol. Metab. 82 (2), 465-472 (1997); rat (SEQ ID NO:19) (GenBank M14053) Miesfeld, R., Rusconi, S., Godowski, P. J., Maler, B. A., Okret, S.,Wikstrom, A. C., Gustafsson, J. A. and Yamamoto, K. R. Cell 46 (3), 389-399 (1986); mouse (SEQ ID NO:20) (GenBank X04435) Danielsen, M., Northrop, J. P. and Ringold, G. M. EMBO J. 5 (10), 2513-2522 (1986); Human (SEQ ID NO:21) (PIR Accession NumberQRHUGA) Hollenberg, S. M., Weinberger, C., Ong, E. S., Cerelli, G., Oro, A., Leba, R., Thompson, E. B., Rosenfeld, M. G., Evans, R. M., Nature (1985) 318: 635-641.

FIG. 7. Ribbon diagram of the LBDs of 11 NHRs detailed in FIG. 2, based on a consensus alignment paradigm (ICM, Molsoft LLC, La Jolla, Calif.). The glucocorticoid receptor (GR) homology model is represented by the blue ribbon.

FIG. 8. Graphic demonstration that in a highly sensitive, artificial assay, mutations in Site II inhibit the ability of Site II ligands to induce transactivation, whereas there was a minimal effect on the Site I compound dexamethasone. RLU onthe Y-axis is relative light units, a measurement of transactivation. Various mutants and the wild-type are given on the X-axis. Compound A, a Site II ligand, is indicated by the left, darker, solid bar in each pair of bars. Dexamethasone is indicatedby the right, lighter, hatched bar in each pair of bars.

FIG. 9. Graphic demonstration that the Site I antagonist RU486 inhibits dexamethasone-mediated repression of AP-1 activity, whereas Site II compounds, such as Compound A and Compound B, act in an additive fashion with dexamethasone to repressAP-1 activity. The Y-axis denotes % inhibition of AP-1 activity. The X-axis denotes concentration of dexarnethasone. Concentrations of RU486, Compound A, and Compound B are denoted by the indicated symbols.

FIG. 10. Graphic demonstration of an assay to indirectly measure the interaction of Site II ligands with GR showing that Site II ligands which do not inhibit dexamethasone on their own can displace other Site II ligands which do inhibitdexamethasone, thereby allowing dexamethasone to bind to GR. Compound D is a Site II ligand that does inhibit dexamethasone. Compound A, Compound B, and Compound C are Site II ligands that do not inhibit dexamethasone on their own. Compound A,Compound B, and Compound C are denoted by the indicated symbols and are the competitor compounds whose concentration is denoted on the X-axis. The Y-axis denotes % inhibition of dexamethasone binding.

FIGS. 11a and 11b. Graphic demonstrations that a Site II ligand inhibits AP-1-mediated transcription in a GR dependent fashion. The Y-axes denote relative light units (RLU), a measurement of AP-1 activity. On the X-axes, Compound A is a SiteII ligand, DEX is dexamethasone, and PMA is phorbol myristic acid. In FIG. 11a, AP-1 activity is measure without the presence of GR. In FIG. 11b, AP-1 activity is measured in the presence of GR.

DETAILED DESCRIPTION OF THE INVENTION

We have identified a second binding site in the ligand binding domain of nuclear hormone receptors (NHRs). We refer to this second binding site as Site II.

Site II is a structure defined by structure coordinates that describe conserved residue backbone atoms having a root mean square deviation of not more than 2.0 .ANG. from the conserved residue backbone atoms described by the structurecoordinates of amino acids E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:13 according to Table I. That is, a Site II is any structure that falls within the given root mean square deviation. Table I is located under the heading for Example 21.

FIG. 2 shows the amino acids of Site II in various human NHRs. The structure coordinates of Site II in the NHRs of FIG. 2 are given in Table III, located under the heading for Example 22. Two sets of xray structure coordinates of Site II in GRare given in Table IV, located under the heading for Example 23, and Table V, located under the heading for Example 24. FIG. 6 shows the amino acids of Site II in the GR of various species.

We have found that ligands of Site II modulate NHRs. Ligands of Site II induce transrepression. Ligands of Site II possess dissociated activity. Ligands of Site II antagonize transactivation.

For all of the present inventions described further below, the following information on possible and preferable embodiments applies.

Said Site II preferably is a nuclear hormone receptor (NHR) Site II, more preferably steroid hormone receptor (SHR) Site II, most preferably a glucocorticoid receptor (GR) Site II.

Said NHR is preferably an SHR, more preferably a GR.

Preferably said NHR is selected from the group consisting of: RXR-alpha; RXR-beta; progesterone receptor (PR); androgen receptor (AR); estrogen receptor-alpha (ER-alpha); ER-beta; vitamin D receptor (VitDR); peroxisome proliferator activatedreceptor-gamma (PPAR-gamma); thyroid receptor-alpha (TR-alpha); TR-beta; mineralocorticoid receptor (MR); and glucocorticoid receptor (GR). More preferably, said NHR is selected from the group consisting of: RXR-alpha; RXR-beta; progesterone receptor(PR); androgen receptor (AR); vitamin D receptor (VitDR); peroxisome proliferator activated receptor-gamma (PPAR-gamma); thyroid receptor-alpha (TR-alpha); TR-beta; mineralocorticoid receptor (MR); and glucocorticoid receptor (GR). Most preferably, saidNHR is selected from the group consisting of: RXR-alpha; RXR-beta; androgen receptor (AR); vitamin D receptor (VitDR); peroxisome proliferator activated receptor-gamma (PPAR-gamma); thyroid receptor-alpha (TR-alpha); TR-beta; mineralocorticoid receptor(MR); and glucocorticoid receptor (GR).

Preferably said SHR is selected from the group consisting of: PR; AR; ER-alpha; ER-beta; MR; and GR. More preferably, said SHR is selected from the group consisting of: PR; AR; MR; and GR. Most preferably, said SHR is selected from the groupconsisting of: AR; MR; and GR.

Said RXR-alpha Site II preferably is composed of amino acids L236-P244, A272-A273, Q276-W283, G305-S313, H316-R317, A320-V321, T329, L368-G369, and R372 of SEQ ID NO:3 according to FIG. 2. Preferably said structure coordinates of said RXR-alphaSite II define the structure of amino acids L236-P244, A272-A273, Q276-W283, G305-S313, H316-R317, A320-V321, T329, L368-G369, and R372 of SEQ ID NO:3 according to Table III, or define the structure of the conserved residue backbone atoms according toTable III. By this it is meant that preferably said structure coordinates define the same shape as the structure of the amino acids according to Table III, or as the structure of the residue backbone atoms according to Table II, but not necessarily thatthe structure coordinates are identical to those of the amino acids or residue backbone atoms in the table, as the structure coordinates may be of a coordinate system other than Cartesian coordinates. More preferably, said structure coordinates of saidSite II are the structure coordinates of Site II amino acids L236-P244, A272-A273, Q276-W283, G305-S313, H316-R317, A320-V321, T329, L368-G369, and R372 of SEQ ID NO:3 according to Table III.

Said RAR-gamma Site II preferably is composed of amino acids S194-P202, L233-A234, C237-F244, A266-R274, T277-R278, T280-E282, D290, T328-G329 and S332 of SEQ ID NO:4 according to FIG. 2. Preferably said structure coordinates of said RAR-gammaSite II define the structure of amino acids S 194-P202, L233-A234, C237-F244, A266-R274, T277-R278, T280-E282, D290, T328-G329 and S332 of SEQ ID NO:4 according to Table III, or define the structure of the conserved residue backbone atoms according toTable III. More preferably, said structure coordinates of said Site II are the structure coordinates of Site II amino acids S194-P202, L233-A234, C237-F244, A266-R274, T277-R278, T280-E282, D290, T328-G329 and S332 of SEQ ID NO:4 according to Table III.

Said PR preferably is composed of amino acids M692-V698, L721-G722, Q725-W732, S754-G762, W765-R766, K769-H770, P780, F818-L819 and K822 of SEQ ID NO:5 according to FIG. 2. Preferably said structure coordinates of said PR Site II define thestructure of amino acids M692-V698, L721-G722, Q725-W732, S754-G762, W765-R766, K769-H770, P780, F818-L819 and K822 of SEQ ID NO:5 according to Table III, or define the structure of the conserved residue backbone atoms according to Table III. Morepreferably, said structure coordinates of said Site II are the structure coordinates of Site II amino acids M692-V698, L721-G722, Q725-W732, S754-G762, W765-R766, K769-H770, P780, F818-L819 and K822 of SEQ ID NO:5 according to Table III.

Said AR Site II preferably is composed of amino acids E678-V684, L708-G709, Q712-W719, S741-A749, W752-R753, T756-N757, P767, F805-L806 and K809 of SEQ ID NO:6 according to FIG. 2. Preferably said structure coordinates of said AR Site II definethe structure of amino acids E678-V684, L708-G709, Q712-W719, S741-A749, W752-R753, T756-N757, P767, F805-L806 and K809 of SEQ ID NO:6 according to Table III, or define the structure of the conserved residue backbone atoms according to Table III. Morepreferably, said structure coordinates of said Site II are the structure coordinates of Site II amino acids E678-V684, L708-G709, Q712-W719, S741-A749, W752-R753, T756-N757, P767, F805-L806 and K809 of SEQ ID NO:6 according to Table III.

Said ER-alpha Site II preferably is composed of amino acids L320-1326, L348-A349, E352-W359, A381-G389, W392-R393, E396, P405, F444-V445 and K448 of SEQ ID NO:7 according to FIG. 2. Preferably said structure coordinates of said ER-alpha Site IIdefine the structure of amino acids L320-1326, L348-A349, E352-W359, A381-G389, W392-R393, E396, P405, F444-V445 and K448 of SEQ ID NO:7 according to Table III, or define the structure of the conserved residue backbone atoms according to Table III. Morepreferably, said structure coordinates of said Site II are the structure coordinates of Site II amino acids L320-1326, L348-A349, E352-W359, A381-G389, W392-R393, E396, P405, F444-V445 and K448 of SEQ ID NO:7 according to Table III.

Said ER-beta Site II preferably is composed of amino acids L273-H279, L297-A298, E301-W308, C330-G338, W341-R342, D345, P354, Y393-L394 and K397 of SEQ ID NO:8 according to FIG. 2. Preferably said structure coordinates of said ER-beta Site IIdefine the structure of amino acids L273-H279, L297-A298, E301-W308, C330-G338, W341-R342, D345, P354, Y393-L394 and K397 of SEQ ID NO:8 according to Table III, or define the structure of the conserved residue backbone atoms according to Table III. Morepreferably, said structure coordinates of said Site II are the structure coordinates of Site II amino acids L273-H279, L297-A298, E301-W308, C330-G338, W341-R342, D345, P354, Y393-L394 and K397 of SEQ ID NO:8 according to Table III.

Said VitDR Site II preferably is composed of amino acids L136-D144, L182-VI 83, S186-F193, S215-R223, E226-S227, T229-D231, G238, H279-V280 and M283 of SEQ ID NO:9 according to FIG. 2. Preferably said structure coordinates of said VitDR Site IIdefine the structure of amino acids L136-D144, L182-V183, S186-F193, S215-R223, E226-S227, T229-D231, G238, H279-V280 and M283 of SEQ ID NO:9 according to Table III, or define the structure of the conserved residue backbone atoms according to Table III. More preferably, said structure coordinates of said Site II are the structure coordinates of Site II amino acids L136-D144, L182-V183, S186-F193, S215-R223, E226-S227, T229-D231, G238, H279-V280 and M283 of SEQ ID NO:9 according to Table III.

Said PPAR-gamma Site II preferably is composed of amino acids Y219-P227, R288-S289, A292-Y299, G321-M329, S332-L333, N335-K336, E343, L384-A385 and I388 of SEQ ID NO:10 according to FIG. 2. Preferably said structure coordinates of saidPPAR-gamma Site II define the structure of amino acids Y219-P227, R288-S289, A292-Y299, G321-M329, S332-L333, N335-K336, E343, L384-A385 and I388 of SEQ ID NO:10 according to Table III, or define the structure of the conserved residue backbone atomsaccording to Table III. More preferably, said structure coordinates of said Site II are the structure coordinates of Site II amino acids Y219-P227, R288-S289, A292-Y299, G321-M329, S332-L333, N335-K336, E343, L384-A385 and I388 of SEQ ID NO:10 accordingto Table III.

Said MR Site II preferably is composed of amino acids E743-1749, L772-A773, Q776-W783, S805-A813, W816-R817, K820-H821, P831, Y869-T870 and K873 of SEQ ID NO:11 according to FIG. 2. Preferably said structure coordinates of said MR Site II definethe structure of amino acids E743-1749, L772-A773, Q776-W783, S805-A813, W816-R817, K820-H821, P831, Y869-T870 and K873 of SEQ ID NO:11 according to Table III, or define the structure of the conserved residue backbone atoms according to Table III. Morepreferably, said structure coordinates of said Site II are the structure coordinates of Site II amino acids E743-1749, L772-A773, Q776-W783, S805-A813, W816-R817, K820-H821, P831, Y869-T870 and K873 of SEQ ID NO:11 according to Table III.

Said TR-beta Site II preferably is composed of amino acids T226-Q235, 1267-1268, A271-F278, C300-R308, V311-R312, D314-E316, G324, V362-A363 and Q366 of SEQ ID NO:12 according to FIG. 2. Preferably said structure coordinates of said TR-beta SiteII define the structure of amino acids T226-Q235, 1267-1268, A271-F278, C300-R308, V311-R312, D314-E316, G324, V362-A363 and Q366 of SEQ ID NO:12 according to Table III, or define the structure of the conserved residue backbone atoms according to TableIII. More preferably, said structure coordinates of said Site II are the structure coordinates of Site II amino acids T226-Q235, 1267-1268, A271-F278, C300-R308, V311-R312, D314-E316, G324, V362-A363 and Q366 of SEQ ID NO:12 according to Table III.

Said GR Site II preferably is composed of amino acids E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:13 according to FIG. 2. Preferably said structure coordinates of said GR Site IIdefine the structure of amino acids E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:13 according to Table I, Table III, Table IV or Table V, or define the structure of the aforementioned aminoacids according to the structure coordinates disclosed in Bledsoe, et. al., Cell, online publication by Cell Press, Jul. 1, 2002; DOI: 10.1016/S0092867402008176, or define the structure of the conserved residue backbone atoms according to any of theaforementioned. Preferably, said structure coordinates of said Site II are the structure coordinates of Site II amino acids E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:13 according to TableI, Table III, Table IV or Table V.

Said GR Site II is preferably selected from the group consisting of: human GR Site II composed of amino acids E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:19 according to FIG. 6;squirrel GR Site II composed of amino acids E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:14 according to FIG. 6; pig GR Site II composed of amino acids E501-V507, L530, G531, Q534-W541,S563-A571, W574, R575, R578, Q579, P589, Y627, L628 and K631 of SEQ ID NO:15 according to FIG. 6; guinea pig GR Site II composed of amino acids E531-V537, L560, G561, Q564-W571, S593-A601, W604, R605, K608, Q609, P619, Y557, L558 and K561 of SEQ ID NO:16according to FIG. 6; marmoset GR Site II composed of amino acids E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:17 according to FIG. 6; ma'z monkey GR Site II composed of amino acids E537-V543,L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:18 according to FIG. 6; rat GR Site II E555-V561, L584, G585, Q588-W595, S617-A625, W628, R629, R632, Q633, P643, Y681, L682 and K685 of SEQ ID NO:20according to FIG. 6; and mouse GR Site II E543-V549, L572, G573, Q576-W583, S605-A613, W616, R617, R620, Q621, P631, Y669, L670 and K673 of SEQ ID NO:21 according to FIG. 6.

Said nuclear hormone receptor can be of any source, preferably human.

Said glucocorticoid receptor can be of any source, preferably human, rat, mouse, sheep, marmoset, squirrel, pig, guinea pig, or ma'z monkey. Most preferably said glucorticoid receptor is human.

Said NHR Site II may be native or mutant. Preferably said NHR Site II is a native NHR Site II. Said SHR Site II maybe native or mutant. Preferably said SHR Site II is a native SHR Site II. Said GR Site II may be native or mutant. Preferablysaid GR Site II is a native GR Site II.

Said Site II may be found on a protein of any source, including mammalian, fungal, bacterial and plant. Preferably said Site II is found on a mammalian protein, more preferably on a human protein.

Preferably the conserved residue backbone atoms of said Site II have a root mean square deviation of less than 1.9, 1.8, 1.7, 1.6 or 1.5 .ANG., more preferably of less than 1.4, 1.3, 1.2, 1.1, 1.03, 1.02, or 1.0 .ANG., yet more preferably of lessthan 0.93, 0.92, 0.9, 0.8, 0.7, 0.6 0.5, 0.4, 0.3, 0.2, or 0.1 .ANG., most preferably 1.02, 0.92 or 0.0 .ANG. from the conserved residue backbone atoms described by the structure coordinates of amino acids E537-V543, L566, G567, Q570-W577, S599-A607,W610, R611, R614, Q615, P625, Y663, L664 and K667 according to Table I.

Preferably the conserved residue backbone atoms of said Site II have a root mean square deviation of less than 2.0, 1.9, 1.8, 1.7, 1.6 or 1.5 .ANG., more preferably of less than 1.4, 1.3, 1.2, 1.1, 1.03, 1.02, or 1.0 .ANG., yet more preferably ofless than 0.93, 0.92, 0.9, 0.8, 0.7, 0.6 0.5, 0.4, 0.3, 0.2, or 0.1 .ANG., most preferably 1.02, 0.92 or 0.0 .ANG. from the conserved residue backbone atoms described by the structure coordinates of amino acids E537-V543, L566, G567, Q570-W577,S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 according to Table IV.

Preferably the conserved residue backbone atoms of said Site II have a root mean square deviation of less than 2.0, 1.9, 1.8, 1.7, 1.6 or 1.5 .ANG., more preferably of less than 1.4, 1.3, 1.2, 1.1, 1.03, 1.02, or 1.0 .ANG., yet more preferably ofless than 0.93, 0.92, 0.9, 0.8, 0.7, 0.6 0.5, 0.4, 0.3, 0.2, or 0.1 .ANG., most preferably 1.02, 0.92 or 0.0 .ANG. from the conserved residue backbone atoms described by the structure coordinates of amino acids E537-V543, L566, G567, Q570-W577,S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 according to Table V.

Said structure coordinates may be those determined for a Site II to which a ligand is bound or to which no ligand is bound. Said structure coordinates may be those determined for a Site II of a ligand binding domain in which a Site I ligand isbound to Site I. Said structure coordinates may be those determined for a Site II of an NHR that is in monomer, dimer, or other form.

As is illustrated in FIG. 3, the cavity circumscribed by Site II and the cavity circumscribed by Site I (in GR, the dexamethasone binding site) share a common wall section. That is, some amino acids are common to both Site II and Site I. Howeverthe cavity circumscribed by Site II is distinct from the cavity circumscribed by Site I, as the two cavities are on opposite sides of the common wall. We manually docked dexamethasone into GR Site I (see Example 10) and determined that the followingamino acid residues are in contact distance, i.e. within 2-3 Angstroms, of dexamethasone and thus make up GR Site I: M560, L563, N564, L566, G567, Q570, M601, M604, A605, L608, R611, F623, M639, Q642, M646, L732, Y735, C736, T739 and E748. The followingamino acid residues are common to both GR Site I and Site II: L566, G567, Q570, M601, M604, A605 and R611. The following amino acid residues are unique to GR Site II, i.e. they are not part of GR Site I: E537-V543, V571-W577, S599-W600, F602-L603,F606-A607, W610, R614, Q615, P625, Y663, L664 and K667. The following amino acid residues are unique to GR Site I, i.e. they are not part of GR Site II: M560, L563, N564, L608, F623, M639, Q642, M646, L732, Y735, C736, T739 and E748. The amino acids inother NHRs and non-human GR corresponding to the above-recited GR amino acids can be seen in FIGS. 2 and 6 respectively. We have identified Site II in NHRs as a binding site whose ligands modulate NHRs.

We defined Site II through use of structure coordinates of the ligand binding domain (LBD) of the glucocorticoid receptor (GR), which are provided in Table I. The structure coordinates of the LBD of GR were determined using homology modeling, andlater confirmed based on the xray structural elucidation of the GR LBD provided in Apolito, et. al., in WO 03/015692 A2, published Feb. 27, 2003, and Kauppi et. al. in the Journal of Biological Chemistry Online, JBC Papers In Press asDOI:10.1074/JBC.M212711200, Apr. 9, 2003. Thus, some description of homology models and structure coordinates is appropriate here.

Homology models are useful when there is no experimental information available on the three-dimensional structure of the protein of interest. A three dimensional model can be constructed on the basis of the known structure of a homologousprotein (Greer et. al., 1991, Lesk, et. al., 1992, Cardozo, et. al., 1995, Sali, et. al., 1995). Those of skill in the art will understand that a homology model is constructed on the basis of first identifying a template, or, protein of known structurewhich is similar to the protein without known structure. This can be accomplished through pairwise alignment of sequences using such programs as the MODELLER module found in InsightII (Accelrys, Inc., San Diego, Calif.).

Those of skill in the art will understand that a set of structure coordinates for a protein or part of a protein is a relative set of points that define a shape in three dimensions. For a number of reasons, including those that follow below, thestructure coordinates that define two identical or almost identical shapes may vary slightly. If variations are within an acceptable standard error as compared to the original coordinates, the resulting three-dimensional shape is considered to beequivalent. Thus, for example, a ligand that bound to the structure defined by the structure coordinates of amino acids E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 according to Table I would also beexpected to bind to a site having a shape that fell within the acceptable error. Such sites with structures within the acceptable standard error are also within the scope of this invention.

Various computational analyses are therefore necessary to determine whether a molecule or a portion thereof is sufficiently similar to all or parts of the disclosed homology model to be considered equivalent. Such analyses may be carried out incurrent software applications, such as InsightII (Accelrys Inc., San Diego, Calif.) Version 2000 as described in the User's Guide, online or software applications available in the SYBYL software suite (Tripos Inc., St. Louis, Mo.).

Using the superimposition tool in the program InsightII, for instance, comparisons can be made between different structures and different conformations of the same structure. The procedure used in InsightII to compare structures is divided intofour steps: 1) load the structures to be compared; 2) define the atom equivalencies in these structures; 3) perform a fitting operation; and 4) analyze the results. Each structure is identified by a name. One structure is identified as the target(i.e., the fixed structure); the second structure (i.e., moving structure) is identified as the source structure. Since atom equivalency within InsightII is defined by user input, for the purpose of this invention we will define equivalent atoms asprotein backbone atoms, also known as residue backbone atoms, (N, C.alpha., C and O) for all residues between the two structures being compared. We will also consider only rigid fitting operations. When a rigid fitting method is used, the movingstructure is translated and rotated to obtain an optimum fit with the target structure. The fitting operation uses an algorithm that computes the optimum translation and rotation to be applied to the moving structure, such that the root mean squaredifference of the fit over the specified pairs of equivalent atoms is an absolute minimum. This number, given in Angstroms (.ANG.), is reported by InsightII.

Three-dimensional coordinates give the location of the centers of all atoms in a protein molecule and are typically expressed as Cartesian coordinates (eg, distances in three directions, each perpendicular to the other), or polar coordinates (eg,sets of angle/distance pairs from a universal origin), or internal coordinates (eg, sets of angle/distance pairs from one atom center to the next). Thus, it is possible that an entirely different set of coordinates could define an identical or similarshape, depending on which coordinate system is used.

Slight variations in the individual coordinates, as emanate from generation of similar homology models using different alignment templates, and/or using different methods in generating the homology model, will have minor effects on the overallshape.

Variations in coordinates may also be generated because of mathematical manipulations of the structure coordinates. For example, the structure coordinates set forth in Table I could be manipulated by fractionalization of the structurecoordinates, integer additions or subtractions to sets of the structure coordinates, inversion of the structure coordinates or any combination of the above.

The structure coordinates of an actual xray structure of a protein would be expected to have some variation from the homology model of that very same protein. For example, the location of sidechains may vary to some extent. As examples, thehomology model GR Site II coordinates were compared to the GR Site II x-ray structure coordinates available from the disclosures in WO 03/015692 A2, Feb. 27, 2003 Apolito, et. al. and Kauppi et. al., in the Journal of Biological Chemistry Online, JBCPapers In Press as

DOI:10.1074/jbc.M212711200, Apr. 9, 2003, RCSB file: 1nhz.pdb (GR LBD bound to an antagonist, RU 486). When the backbone atoms of the homology model Site II residues, ie, E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615,P625, Y663, L664 and K667 of SEQ ID NO;13 according to Table I were compared, root mean square deviations (rmsds) of 0.92 and 1.02 .ANG. were obtained between the homology model of Table I Site II residues and the Apolito Site II residues, and betweenthe homology model of Table I Site II residues and the Kauppi Site II residues, respectively. These observations underscore the similarity of the Site II homology model structure to actual crystal structures.

Variations in structure coordinates can be due to mutations, additions, substitutions, and/or deletions of amino acids of a protein being studied.

Variations in structure coordinates can be due to variations in proteins whose shape is being described by the structure coordinates given. For instance, rigid fitting operations conducted (see Example 13) between the GR LBD homology model andseveral closely-related NHRs known to have similar structure and function (ie, progesterone receptor LBD, androgen receptor LBD, estrogen receptor alpha LBD and estrogen receptor beta LBD as examples) yielded Site II root mean square (rms) deviations inconserved residue backbone atom comparisons of 0.57-0.71 .ANG.. These Site II rms deviations could be greater if other variation factors described above were present in the calculations. GR LBDs from non-human species may also have slight variations inshape from that of human GR LBD defined by the structure coordinates in Table 1.

For the purpose of this invention, any structure that has a root mean square deviation of residue backbone atoms (N, C.alpha., C, O) of less than 2.0 Angstroms (.ANG.) when superimposed on the relevant residue backbone atoms described bystructure coordinates listed in Table I is considered to be equivalent. Preferably the root mean square deviation is less than 1.9, 1.8, 1.7, 1.6 or 1.5 .ANG., more preferably of less than 1.4, 1.3, 1.2, 1.1, 1.03, 1.02, or 1.0 .ANG., yet morepreferably of less than 0.93, 0.92, 0.9, 0.8, 0.7, 0.6 0.5, 0.4, 0.3, 0.2, or 0.1 .ANG., most preferably 1.02, 0.92 or 0.0 .ANG..

Within the context of the present invention, "conserved" refers to a portion of a protein backbone which is found in common between two proteins. That is, if portions of two proteins are aligned and compared using the three-dimensionalcoordinates of their residue backbone atoms for super-positioning, and comparison of the structure coordinates of the residue backbone atoms yields an rms of 2.0 .ANG. or less, then the residue backbone atoms are considered to be conserved between thetwo proteins.

We made the claimed inventions through a series of experiments described below in the Examples. To help in understanding the invention, that series of experiments is summarized here.

Twenty-seven compounds, which are analogues, were synthesized and shown to inhibit GR binding in GR Site I binding assays and to induce transrepression in AP-1 cellular transrespressional assays. Some of these compounds were tested in cellulartranscriptional assays and shown to induce none to minimal transactivation. Thus these compounds were shown to have dissociated activity.

Twelve analogues of the twenty-seven compounds (some of which are among the twenty-seven compounds) were synthesized and the racemic mixtures were separated into enantiomers. Each of these twenty-four enantiomers was tested in the GR bindingassay and the cellular transrepressional assay. It was observed that the S enantiomer of each pair induced AP-1 inhibitory activity when GR was present but did not inhibit well dexamethasone binding to GR, while the R enantiomer of each pair inducedminimal AP-1 inhibitory activity when GR was present and inhibited well dexamethasone binding to GR. Each enantiomer was also tested in the cellular transcriptional assay and induced none to minimal transactivation. This suggested that there is analternate site on GR to which these compounds bind that does not result in inhibition of dexamethasone binding to GR.

A homology model of the ligand binding domain (LBD) of GR was constructed using the known crystal structure of the progesterone receptor (PR). Site II in the LBD of GR was identified by the complementarity of three-dimensional shape andfunctional features between the Site II and compounds having AP-1 inhibitory activity. Manual docking of one such compound was performed and confirmed the identity of Site II and its role in transrepression. Binding energetics of the S enantomer of thetwenty-seven compounds to Site II were calculated and correlated with AP-1 inhibitory activity of these compounds. This positive correlation further confirmed the identity and role of Site II.

As binding energetics to Site II correlates to AP-1 inhibitory activity and all compounds that were tested for binding to Site II are dissociated compounds, Site II was determined to be a target for compounds that have AP-1 inhibitory activity aswell as compounds that have dissociated activity.

Additional studies were performed to elucidate the relationship between binding at Site II and binding at Site I. One S enantiomer and dexamethasone were used concurrently in cellular transrepressional assays and cellular transcriptional assays. In the cellular transrepressional assays, it was observed that the dissociated compound (i.e. the S enantiomer) and dexamethasone had an additive effect on AP-1 inhibitory activity. In the cellular transcriptional assays, it was observed that thepresence of a dissociated compound along with dexamethasone reduced transactivation as compared to dexamethasone alone.

The cellular transcriptional assay was performed with a titration of dexamethasone in the presence or absence of each of both enantiomers of a pair. Again, an additive effect on AP-1 inhibitory activity was seen with each of the enantiomers anddexamethasone. In contrast, the Site I antagonist RU 486 inhibited the ability of dexamethasone to induce transrepression.

Other studies performed have shown that mutations in Site II alter the ability of an S enantiomer to modulate GR function. In a highly sensitive, artificial assay system to measure transactivation, it was shown that mutations of residues 543 or607 prevented the compound from inducing transactivation, whereas, in the wild type protein transactivation was seen. Dexamethasone induced transactivation in both the mutants and the wild type protein.

A further study demonstrated that both an S enantiomer and dexamethasone act in a GR-dependent fashion.

The studies performed to date suggest that both enantiomers interact with Site II. Example 17 shows that both enantiomers R (Compound B) and S (Compound A) act in an additive fashion with saturating levels of dexamethasone to suppress AP-1activity. Since dexamethasone binds to Site I, it is most likely that the R and S enantiomers interact with Site II to allosterically enhance the repressive activity.

The following definitions are provided to more fully describe the present invention in its various aspects. The definitions are intended to be useful for guidance and elucidation, and are not intended to limit the disclosed invention and itsembodiments. Additional definitions may be provided elsewhere in the specification.

The terms "nuclear hormone receptor" and "NHR," as used herein, refer to a member of the nuclear hormone receptor family of transcription factors which bind low molecular weight ligands and stimulate or repress transcription. NHRs include, butare not limited to, glucocorticoid receptors (GRs), progesterone receptors (PRs), androgen receptors (ARs), estrogen receptors (ERs), mineralocorticoid receptors (MRs), retinoid receptors (RXRs and RARs), Vitamin D receptors (VitDRs), thyroid receptors(TRs), peroxisome proliferator activated receptors (PPARs), and orphan nuclear receptors (i.e. receptors for which the ligands are not yet identified) that bind nuclear hormones. "Nuclear hormone receptor" includes orphan nuclear receptors, which aregene products that embody structural features of nuclear hormone receptors and were identified without any prior knowledge of their association with a putative ligand.

The structural features that define a nuclear hormone receptor, including an orphan nuclear receptor, are the four following features (as disclosed in Giguere, V. (1999) Endocrine Reviews 20(5) p 689: 1. An NHR has a modulator domain includingthe AF-1 domain responsible in part for transcriptional activation function. Modulator domains can also include regions for promoters and cell-specific cofactors and can interact with steroid receptor co-activators (SRCs). 2. An NHR has a DNA bindingdomain (DBD) composed of two zinc finger modules composed of 60-70 amino acids and a carboxy-terminal extension (CTE) that providesprotein-protein and protein-DNA interactions upon homo- or heterodimer receptorbinding. 3. An NHR has a hinge region thatis the hinge between the DBD and the carboxy-terminal ligand binding domain. The hinge region is variable is primary structure and amino acid sequence length. 4. An NHR has a ligand binding domain (LBD) that contains the AF-2 motif (which correspondsto helix 12 of NHRs) and provides a structured region whereby AF-2 (helix 12) is packed closely to the LBD core forming an interface with at least 3 other helices of the core. The interface is involved with binding of co-activator or co-repressorpolypeptides.

"Nuclear hormone receptor" and "NHR," as used herein, refer to NHRs from any source, including but not limited to: glucocorticoid receptor as disclosed in Hollenberg, S. M., Weinberger, C., Ong, E. S., Cerelli, G., Oro, A., Leba, R., Thompson, E.B., Rosenfeld, M. G., Evans, R. M., Nature (1985) 318: 635-641 progesterone receptor as disclosed in Misrahi, M. et al. (1987) Biochem. Biophys. Res. Commun. 143, p 740; androgen receptor as disclosed in Lubahn D. B., et al (1988); estrogen receptorsas disclosed in Green, S., et al. (1986) Nature 320, p 134); mineralocorticoid receptor as disclosed in Arriza, J. L., et al., (1987) Science 237, p 268; retinoid receptors (RXRs and RARs) as disclosed in Mangelsdorf, et al. (1990) Nature, 345, p 224 andPetkovich M., et al (1987) Nature 330, p 444; Vitamin D receptor, thyroid receptor (TR) as disclosed in Nakai, A. et al., (1988) Mol. Endocrinol. 2, p 1087; peroxisome proliferator activated receptor (PPAR) as disclosed in Greene, M. E., et al. (1995)Gene Expression 4, p 281; RXRalpha (1lbd) as disclosed in Bourguet, W., Ruff, M., Chambon, P., Gronemeyer, H., Moras, D. Nature 375 pp. 377 (1995); PPARgamma (2prg) as disclosed in Nolte, R. T., Wisely, G. B., Westin, S., Cobb, J. E., Lambert, M. H.,Kurokawa, R., Rosenfeld, M. G., Willson, T. M., Glass, C. K., Milburn, M. V. Nature 395 pp. 137 (1998); RARgamma (2lbd) as disclosed in Renaud, J. P., Rochel, N., Ruff, M., Vivat, V., Chambon, P., Gronemeyer, H., Moras, D. Nature 378 pp. 681 (1995); PR(1a28) as disclosed in Williams, S. P., Sigler, P. B. Nature 393 pp. 392 (1998); VitDR (1db1) as disclosed in Rochel, N., Wurtz, J. M., Mitschler, A., Klaholz, B., Moras, D. Mol. Cell 5 pp. 173 (2000); AR (1e3g) as disclosed in Matias, P. M., Donner,P., Coelho, R., Thomaz, M., Peixoto, C., Macedo, S., Otto, N., Joschko, S., Scholz, P., Wegg, A., Basler, S., Schafer, M., Egner, U., Carrondo, M. A. J. Biol. Chem. 275 pp. 26164 (2000); ERalpha (1 as2) as disclosed in Tanenbaum, D. M., Wang, Y.,Williams, S. P., Sigler, P. B. Proc Natl Acad Sci USA 95 pp. 5998 (1998); ERbeta (1l2j) as disclosed in Shiau, A. K., Barstad, D., Radek, J. T., Meyers, M. J., Nettles, K. W., Katzenellenbogen, B. S., Katzenellenbogen, J. A., Agard, D. A., Greene, G. L.Nat. Struct. Biol. 9 pp. 359 (2002); TRbeta (1bsx) as disclosed in Wagner, R. L., Darimont, B. D., Apriletti, J. W., Stallcup, M. R., Kushner, P. J., Baxter, J. D., Fletterick, R. J., Yamamoto, K. R. Genes Dev. 12 pp. 3343 (1998); GR, PIR AccessionNumber QRHUGA, as dislcosed in Hollenberg, S. M., Weinberger, C., Ong, E. S.; Cerelli, G., Oro, A., Leba, R., Thompson, E. B., Rosenfeld, M. G., Evans, R. M., Nature (1985) 318: 635-641; MR, PIR Accession Number A29613, as disclosed in Arriza, J. L.;Weinberger, C., Cerelli, G., Glaser, T. M., Handelin, B. L., Housman, D. E., Evans, R. M., Science (1987) 237: 268-275. Orphan nuclear receptors include but are not limited to: Rev Erb (alpha) (1hlz) as disclosed in Sierk, M. L., et. al., Biochemistry(2001) 40: pp. 12833; Pxr (1ilh) as disclosed in Watkins, R. E., et. al., Science (2002) 292: pp. 2329; ERR3 (1 kv6) as disclosed in Greschik, H., et. al., Mol. Cell (2002) 9: pp. 303; Nurrl (1ovl) as disclosed in Wang, Z., et. al., Nature (2003) 423:pp. 555; ERR1 as disclosed in Guiguere, V., et al., Nature (1988) 331: 91-94. Other NHRs, including orphan nuclear receptors, include those disclosed in: The Nuclear Receptor Facts Book, V. Laudet and H. Gronemeyer, Academic Press, p 345, 2002; andFrancis et al, Annu. Rev. Physiol. 2003, 65:261-311.

The terms "steroid hormone receptor" and "SHR," as used herein, refer to a member of the nuclear hormone receptor family of transcription factors which bind steroids and stimulate or repress transcription. SHRs include, but are not limited to,glucocorticoid receptors (GRs), progesterone receptors (PRs), androgen receptors (ARs), estrogen receptors (ERs), mineralocorticoid receptors (MRs), and orphan receptors (i.e. receptors for which the ligands are not yet identified) that bind steroids. These terms, as used herein, refer to steroid hormone receptors from any source, including but not limited to human.

The terms "glucocorticoid receptor" and "GR," as used herein, refer to a member of the nuclear hormone receptor family of transcription factors which bind glucocorticoids and stimulate or repress transcription, and to the GR-beta isoform. Theseterms, as used herein, refer to glucocorticoid receptor from any source, including but not limited to: human glucocorticoid receptor as disclosed in Weinberger, et al. Science 228, p 740-742, 1985, and in Hollenberg, S. M., Weinberger, C., Ong, E. S.,Cerelli, G., Oro, A., Leba, R., Thompson, E. B., Rosenfeld, M. G., Evans, R. M.; Nature (1985) 318: 635-641; rat glucocorticoid receptor as disclosed in Miesfeld, R. Nature, 312, p 779-781, 1985; mouse glucocortoid receptor as disclosed in Danielson, M.et al. EMBO J., 5, 2513; sheep glucocorticoid receptor as disclosed in Yang, K., et al. J. Mol. Endocrinol. 8, p 173-180, 1992; marmoset glucocortoid receptor as disclosed in Brandon, D. D., et al, J. Mol. Endocrinol. 7, p 89-96, 1991; human GR-beta asdisclosed in Hollenberg, S M. et al. Nature, 318, p 635, 1985, Bamberger, C. M. et al. J. Clin Invest. 95, p 2435, 1995; Squirrel (Saimiri boliviensis boliviensis) (GenBank U87951) as disclosed in Reynolds, P. D., Pittler, S. J. and Scammell, J. G. J.Clin. Endocrinol. Metab. 82 (2), 465-472 (1997); Pig GR (GenBank AF141371) as disclosed in Gutscher, M., Eder, S., Mueller, M. and Claus, R. Submitted to GenBank (08-APR-1999) Institut fuer Tierhaltung und Tierzuechtung (470), FG Tierhaltung undLeistungsphysiologie, Universitaet Hohenheim, Garbenstr. 17, Stuttgart 70599, Germany; Guinea Pig (GenBank L13196) as disclosed in Keightley, M. C. and Fuller, P. J. Mol. Endocrinol. 8 (4), 431-439 (1994); Marmoset (GenBank U87953) as disclosed inReynolds, P. D., Pittler, S. J. and Scammell, J. G. J. Clin. Endocrinol. Metab. 82 (2), 465-472 (1997); Ma'z Monkey (GenBank U87952) as disclosed in Reynolds, P. D., Pittler, S. J. and Scammell, J. G. J. Clin. Endocrinol. Metab. 82 (2), 465-472 (1997);rat (GenBank M14053) as disclosed in Miesfeld, R., Rusconi, S., Godowski, P. J., Maler, B. A., Okret, S., Wikstrom, A. C., Gustafsson, J. A. and Yamamoto, K. R. Cell 46 (3), 389-399 (1986); mouse (GenBank X04435) as disclosed in Danielsen, M., Northrop,J. P. and Ringold, G. M. EMBO J. 5 (10), 2513-2522 (1986); Human (Protein Information Resource (PIR) Accession Number QRHUGA) as disclosed in Hollenberg, S. M., Weinberger, C., Ong, E. S., Cerelli, G., Oro, A., Leba, R., Thompson, E. B., Rosenfeld, M.G., Evans, R. M., Nature (1985) 318: 635-641.

The term "binding site," as used herein, refers to a region of a molecule or molecular complex that, as a result of its shape, favorably associates with, i.e. binds, another molecule, such other molecule being a ligand of the binding site. Abinding site, such as Site II, is analogous to a wall and circumscribes a space referred to as a "cavity" or "pocket." The ligand of the binding site situates in the cavity.

The terms "binds" in all its grammatical forms, as used herein, refers to a condition of proximity between or amongst molecules, chemical compounds or chemical entities. The association may be non-covalent (i.e. non-bonded or reversible),wherein the juxtaposition is energetically favored by hydrogen bonding or van der Waals or electrostatic interactions, or it may be covalent (i.e. bonded or irreversible).

The term "soaked," as used herein, refers to a process in which the protein crystal is transferred to a solution containing the compound of interest.

The terms "at least a portion of," "a portion of," "any part of," and "any portion of," in all their grammatical forms, as used herein when referring to Site II, or the structure coordinates of Site II, or the cavity circumscribed by Site II,refer to all or any part of Site II, or the structure coordinates of Site II, or the cavity circumscribed by Site II, wherein Site II is a structure defined by structure coordinates that describe conserved residue backbone atoms having a root mean squaredeviation of not more than 2.0 .ANG. from the conserved residue backbone atoms described by the structure coordinates of amino acids E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 according to Table I.Preferably the terms relate to a sufficient number of residues or the corresponding structure coordinates so as to be useful in docking or modeling a ligand in the cavity circumscribed by Site II. Preferably, the terms comprise one or more of thefollowing residues or the corresponding structure coordinates: E537-V543, V571-W577, S599-W600, F602-L603, F606-A607, W610, R614, Q615, P625, Y663, L664 and K667. These are the residues of Site II that are not also part of Site I. More preferably, theterms comprise one or more of the following residues or the corresponding structure coordinates: E537-V543, V571-W577, S599-W600, F602-L603, F606-A607, W610, R614, Y663, L664 and K667. Preferably, the terms relate to at least four amino acid residues,more preferably at least five amino acids, more preferably at least eight amino acid residues, more preferably at least fifteen amino acid residues, more preferably at least twenty amino acid residues, more preferably at least twenty-five amino acidresidues, most preferably at least thirty amino acid residues.

The term "mutant," as used herein, refers to a protein, or portion of protein, having one or more amino acid deletions, insertions, inversions, repeats, or substitutions as compared to the relevant native protein or relevant portion of nativeprotein. A native protein is one occurring in nature. A mutant Site II falls within the scope of this invention so long as the rms deviation in conserved residue backbone atoms between such mutant Site II and the the Site II residues according to TableI falls within 2.0 Angstroms. A mutant may have the same, similar, or altered activity as compared to the native protein. Activity refers to transrepression, transactivation, and ligand binding. Preferred mutants have at least 25% sequence identity,more preferably at least 50% sequence identity, more preferably at least 75% sequence identity, and most preferably at least 95% sequence identity to the native protein or portion of native protein.

The term "root mean square deviation" means the square root of the arithmetic mean of the squares of the deviations from the mean. It is a way to express the deviation or variation from a trend or object. For purposes of this invention, the"root mean square deviation" defines the variation in the backbone of a protein or portion of a protein from the relevant portion of the backbone of another protein, such as the LBD defined by the structure coordinates of Table I.

The term "structure coordinates," "structural coordinates," "atomic coordinates," or "atomic structure coordinates" refers to coordinates that specify the location of the centers of atoms in a protein molecule or molecular complex. The termsinclude, but are not limited to, Cartesian coordinates, polar coordinates, and internal coordinates. The structure coordinates may be generated by any means, including the building of a homology model or derivation from mathematical equations related tothe patterns obtained on diffraction of a monochromatic beam of X-rays by the atoms (scattering centers) of a molecule or molecular complex in crystal form. The diffraction data are used to calculate an electron density map of the repeating unit of thecrystal. The electron density maps are then used to establish the positions of the individual atoms of the molecule or molecular complex.

The term "molecule," as used herein, has the meaning generally used in the art and includes, but is not limited to, proteins, nucleic acids, and chemical compounds, including small organic compounds. "Small organic compounds" are also known as"small organic molecules" or "small molecules."

The term "complex" or "molecular complex," as used herein, refers to a covalent or non-covalent association of a molecule with its ligand.

The term "chemical entity," as used herein, refers to chemical compounds, complexes of at least two chemical compounds, and fragments of such chemical compounds or complexes. A modulator may be a chemical entity. A ligand may be a chemicalentity.

The term "compound," as used herein, refers to a chemical compound.

The term "test molecule," as used herein, refers to a molecule, preferably a chemical compound, that is being tested for specific characteristics.

The term "ligand," as used herein, refers to a molecule that binds to another molecule or portion of another molecule.

The term "modulator," as used herein, refers to a molecule whose presence induces an activity in the molecule that it modulates. A modulator can bind to the molecule that it modulates, i.e. be a ligand of the molecule it modulates. A preferredmodulator is a ligand of the molecule that it modulates. Modulators include, but are not limited to, small organic molecules, chemical compounds, peptides, peptidomimetics (eg., cyclic peptides, peptide analogs, or constrained peptides) and nucleicacids. Modulators can be natural or synthetic. Preferred modulators are small organic molecules.

The term "modeling" in all its grammatical forms, as used herein, refers to the development of a mathematical construct designed to mimic real molecular geometry and behavior in proteins and small molecules. These mathematical constructsinclude, but are not limited to: energy calculations for a given geometry of a molecule utilizing forcefields or ab initio methods known in the art; energy minimization using gradients of the energy calculated as atoms are shifted so as to produce alower energy; conformational searching, ie, locating local energy minima; molecular dynamics wherein a molecular system (single molecule or ligand/protein complex) is propagated forward through increments of time according to Newtonian mechanics usingtechniques known to the art; calculations of molecular properties such as electrostatic fields, hydrophobicity and lipophilicity; calculation of solvent-accessible or other molecular surfaces and rendition of the molecular properties on those surfaces;comparison of molecules using either atom-atom correspondences or other criteria such as surfaces and properties; quantitiative structure-activity relationships in which molecular features or properties dependent upon them are correlated with activity orbio-assay data.

The term "fits spatially" in all its grammatical forms, as used herein, refers to when the three-dimensional structure of a compound is accommodated geometrically by a cavity or pocket of a protein, such as the cavity circumscribed by Site II.

The terms "docking" and "performing a fitting operation," in all their grammatical forms, as used herein, refer to the computational placement of a chemical entity (eg. a potential ligand, preferably a small organic molecule) within a space(i.e. cavity) at least partially enclosed by the protein structure (i.e. binding site) so that structural and chemical feature complementarity (i.e. binding contacts) between chemical entity and binding site components can be assessed in terms ofinteractions typical of protein/ligand complexes. Specifically, the structural and chemical features may include both bonded and non-bonded interactions, and more generally, the non-bonded interactions which occur in the bulk of reversibleprotein/ligand complexes would include forces such as hydrogen-bonding, electrostatic or charge interactions, vander Waal's interactions, and hydrophobic interactions. Such placement could be conducted manually or automatically using software designedfor such purpose.

The term "transrepress" or "transrepression," in all their grammatical forms, is used herein to refer to the process in which an NHR represses transcription by inhibiting a transcription factor or coactivator from inducing transcription. Theterm is not limited to any specific mechanism of action, any specific transcription factor or coactivator, or any specific gene whose transcription is repressed. AP-1 and NF-.kappa.B are two transcription factors, among others, that can be inhibited byan NHR.

The term "transactivate" or "transactivation," in all their grammatical forms, is used herein to refer to the process in which an NHR stimulates transcription, either by binding to DNA and inducing transcription, or by modulating the activity ofanother DNA binding protein that induces transcription. The term is not limited to any specific mechanism of action or any specific gene whose transcription is stimulated.

The term, "NF-.kappa.B-dependent gene expression," as used herein, refers to the expression of those genes that are under the regulatory control of the NF-.kappa.B transcription factor. Such genes include, but are not limited to theimmune-related and inflammatory genes encoding TNF-alpha, IL-1, IL-2, IL-5, adhesion molecules (such as E-selectin), chemokines (such Eoxtaxin and Rantes), and Cox-2.

The term, "AP-1-dependent gene expression," as used herein, refers to the expression of genes that are under the regulatory control of the AP-1 transcription factor. Such genes include, but are not limited to the immune-related and inflammatorygenes encoding TNF-alpha, IL-1, IL-2, IL-5, adhesion molecules (such as E-selectin), chemokines (such Eoxtaxin and Rantes), and Cox-2.

The term "dissociated compound" is used herein to refer to a modulator of an NHR that induces transrepression and induces none to minimal transactivation. The term "dissociated activity" refers to the activity in which a dissociated compoundinduces transrepression and induces none to minimal transactivation.

The term "treat", "treating", or "treatment," in all grammatical forms, as used herein refers to the prevention, reduction, or amelioration, partial or complete alleviation, or cure of a disease, disorder, or condition.

The term "NHR-associated disease," as used herein, refers to a disease or disorder associated with the expression product of a gene whose transcription is stimulated or repressed by an NHR. Stimulation is through transactivation. Repression isthrough transrepression. Such diseases include, but are not limited to, inflammatory and immune associated diseases and disorders, diseases associated with AP-1-dependent gene expression, diseases associated with NF-.kappa.B-dependent gene expression,diseases associated with NHR transrepression, diseases associated with NHR transactivation, diseases treatable by inducing NHR transrepression, and diseases treatable by antagonizing NHR transactivation.

The term "SHR-associated disease," as used herein, refers to a disease or disorder associated with the expression product of a gene whose transcription is stimulated or repressed by an SHR. Stimulation is through transactivation. Repression isthrough transrepression. Such diseases include, but are not limited to, inflammatory and immune associated diseases and disorders, diseases associated with AP-1-dependent gene expression, diseases associated with NF-.kappa.B-dependent gene expression,diseases associated with SHR transrepression, diseases associated with SHR transactivation, diseases treatable by inducing SHR transrepression, and diseases treatable by antagonizing SHR transactivation.

The term "GR-associated disease," as used herein, refers to a disease or disorder associated with the expression product of a gene whose transcription is stimulated or repressed by a GR. Stimulation is through transactivation. Repression isthrough transrepression. Such diseases include, but are not limited to, inflammatory and immune associated diseases and disorders, diseases associated with AP-1-dependent gene expression, diseases associated with NF-.kappa.B-dependent gene expression,diseases associated with NHR transrepression, diseases associated with GR transactivation, diseases treatable by inducing GR transrepression, and diseases treatable by antagonizing GR transactivation.

The term "disease associated with NHR transrepression," as used herein, refers to a disease or disorder associated with the transcription product of a gene whose transcription is transrepressed by an NHR. Such diseases include, but are notlimited to, inflammatory and immune associated diseases and disorders, diseases associated with NF-.kappa.B-dependent gene expression, diseases, diseases associated with AP-1-dependent gene expression, and diseases treatable by inducing NHRtransrepression.

The term "disease associated with SHR transrepression," as used herein, refers to a disease or disorder associated with the transcription product of a gene whose transcription is transrepressed by an SHR. Such diseases include, but are notlimited to, inflammatory and immune associated diseases and disorders, diseases associated with NF-.kappa.B-dependent gene expression, diseases, diseases associated with AP-1-dependent gene expression, and diseases treatable by inducing SHRtransrepression.

The term "disease associated with GR transrepression," as used herein, refers to a disease or disorder associated with the transcription product of a gene whose transcription is transrepressed by a GR. Such diseases include, but are not limitedto, inflammatory and immune associated diseases and disorders, diseases associated with NF-.kappa.B-dependent gene expression, diseases, diseases associated with AP-1-dependent gene expression, and diseases treatable by inducing GR transrepression.

The term "disease associated with NHR transactivation," as used herein, refers to a disease or disorder associated with the transcription product of a gene whose transcription is transactivated by an NHR. Such diseases include, but are notlimited to: osteoporosis, diabetes, glaucoma, muscle loss, facial swelling, personality changes, hypertension, obesity, depression, AIDS, the condition of wound healing, prostate cancer, breast cancer, primary or secondary andrenocortical insufficiency,and Addison's disease.

The term "disease associated with SHR transactivation," as used herein, refers to a disease or disorder associated with the transcription product of a gene whose transcription is transactivated by an SHR. Such diseases include, but are notlimited to: osteoporosis, diabetes, glaucoma, muscle loss, facial swelling, personality changes, hypertension, obesity, depression, and AIDS, the condition of wound healing, prostate cancer, breast cancer, primary or secondary andrenocorticalinsufficiency, and Addison's disease.

The term "disease associated with GR transactivation," as used herein, refers to a disease or disorder associated with the transcription product of a gene whose transcription is transactivated by a GR. Such diseases include, but are not limitedto: osteoporosis, diabetes, glaucoma, muscle loss, facial swelling, personality changes, hypertension, obesity, depression, and AIDS, the condition of wound healing, primary or secondary andrenocortical insufficiency, and Addison's disease.

The term, "disease associated with NF-.kappa.B-dependent gene expression," as used herein, refers to a disease or disorder associated with the expression product of a gene under the regulatory control of NF-.kappa.B. Such diseases include, butare not limited to: inflammatory and immune associated diseases and disorders; cancer and tumor disorders, such as solid tumors, lymphomas and leukemia; fungal infections such as mycosis fungoides; ischemic or reperfusion injury such as ischemic orreperfusion injury that may have been incurred during organ transplantation, myocardial infarction, stroke or other causes; and DNA and RNA viral replication diseases, such herpes simplex type 1 (HSV-1), herpes simplex type 2 (HSV-2), hepatitis(including hepatitis B and hepatitis C), cytomegalovirus, Epstein-Barr, and human immunodeficiency virus (HIV).

The term, "disease associated with AP-1-dependent gene expression," as used herein, refers to a disease or disorder associated with the expression product of a gene under the regulatory control of AP-1. Such diseases include, but are not limitedto: inflammatory and immune associated diseases and disorders; cancer and tumor disorders, such as solid tumors, lymphomas and leukemia; and fungal infections such as mycosis fungoides.

The term "inflammatory or immune associated diseases or disorders" is used herein to encompass any condition, disease, or disorder that has an inflammatory or immune component, including, but not limited to, each of the following conditions:transplant rejection (e.g., kidney, liver, heart, lung, pancreas (e.g., islet cells), bone marrow, cornea, small bowel, skin allografts, skin homografts (such as employed in burn treatment), heart valve xenografts, serum sickness, and graft vs. hostdisease, autoimmune diseases, such as rheumatoid arthritis, psoriatic arthritis, multiple sclerosis, juvenile diabetes, asthma, inflammatory bowel disease (such as Crohn's disease and ulcerative colitus), pyoderma gangrenum, lupus (systemic lupuserythematosis), myasthenia gravis, psoriasis, dermatitis, dermatomyositis; eczema, seborrhoea, pulmonary inflammation, eye uveitis, hepatitis, Grave's disease, Hashimoto's thyroiditis, autoimmune thyroiditis, Behcet's or Sjorgen's syndrome (dryeyes/mouth), pernicious or immunohaemolytic anaemia, atherosclerosis, Addison's disease (autoimmune disease of the adrenal glands), idiopathic adrenal insufficiency, autoimmune polyglandular disease (also known as autoimmune polyglandular syndrome),glomerulonephritis, scleroderma, morphea, lichen planus, viteligo (depigmentation of the skin), alopecia greata, autoimmune alopecia, autoimmune hypopituatarism, Guillain-Barre syndrome, and alveolitis; T-cell mediated hypersensitivity diseases,including contact hypersensitivity, delayed-type hypersensitivity, contact dermatitis (including that due to poison ivy), uticaria, skin allergies, respiratory allergies (hayfever, allergic rhinitis) and gluten-sensitive enteropathy (Celiac disease);inflammatory diseases such as osteoarthritis, acute pancreatitis, chronic pancreatitis, asthma, acute respiratory distress syndrome, Sezary's syndrome and vascular diseases which have an inflammatory and or a proliferatory component such as restenosis,stenosis and artherosclerosis. Inflammatory or immune associated diseases or disorders also includes, but is not limited to: endocrine disorders, rheumatic disorders, collagen diseases, dermatologic disease, allergic disease, opthalmic disease,respiratory disease, hematologic disease, gastrointestinal disease, inflammatory disease, autoimmune disease, Congenital adrenal hyperplasia, Nonsuppurative thyroiditis, Hypercalcemia associated with cancer, Psoriatic arthritis, Rheumatoid arthritis,including juvenile rheumatoid arthritis, Ankylosing spondylitis, Acute and subacute bursitis, Acute nonspecific tenosynovitis, Acute gouty arthritis, Post-traumatic osteoarthritis, Synovitis of osteoarthritis, Epicondylitis, Systemic lupus erythematosus,Acute rheumatic carditis, Pemphigus, Bullous dermatitis herpetiformis, Severe erythema multiforme, Exfoliative dermatitis, Psoriasis, Seborrheic dermatitis, Seasonal or perennial allergic rhinitis, Serum sickness, Bronchial asthma, Contact dermatitis,Atopic dermatitis, Drug hypersensitivity reactions, Allergic conjunctivitis, Keratitis, Herpes zoster ophthalmicus, Iritis and iridocyclitis, Chorioretinitis, Optic neuritis, Symptomatic sarcoidosis, Fulminating or disseminated pulmonary tuberculosischemotherapy, Idiopathic thrombocytopenic purpura in adults, Secondary thrombocytopenia in adults, Acquired (autoimmune) hemolytic anemia, Leukemias and lymphomas in adults, Acute leukemia of childhood, Ulcerative colitis, Regional enteritis, Crohn'sdiease, Sjogren's syndrome, Autoimmune vasculitis, Multiple sclerosis, Myasthenia gravis, Anklyosing spondylitis, Chronic obstructive pulmonary disease, Solid organ transplant rejection, Sepsis, and Allergy.

The term "disease treatable by inducing NHR transrepression," as used herein, refers to a disease that can be treated by inducing NHR transrepression. Such diseases include, but are not limited to, inflammatory and immune associated diseases anddisorders.

The term "disease treatable by inducing SHR transrepression," as used herein, refers to a disease that can be treated by inducing SHR transrepression. Such diseases include, but are not limited to, inflammatory and immune associated diseases anddisorders.

The term "disease treatable by inducing GR transrepression," as used herein, refers to a disease that can be treated by inducing GR transrepression. Such diseases include, but are not limited to, inflammatory and immune associated diseases anddisorders.

The term "disease treatable by antagonizing NHR transactivation," as used herein, refers to a disease that can be treated by antagonizing NHR transactivation. Such diseases include, but are not limited to: osteoporosis, diabetes, glaucoma,muscle loss, facial swelling, personality changes, hypertension, obesity, depression, and AIDS, the condition of wound healing, prostate cancer, breast cancer, and primary or secondary andrenocortical insufficiency.

The term "disease treatable by antagonizing SHR transactivation," as used herein, refers to a disease that can be treated by antagonizing SHR transactivation. Such diseases include, but are not limited to: osteoporosis, diabetes, glaucoma,muscle loss, facial swelling, personality changes, hypertension, obesity, depression, and AIDS, the condition of wound healing, prostate cancer, breast cancer, and primary or secondary andrenocortical insufficiency.

The term "disease treatable by antagonizing GR transactivation," as used herein, refers to a disease that can be treated by antagonizing GR transactivation. Such diseases include, but are not limited to: osteoporosis, diabetes, glaucoma, muscleloss, facial swelling, personality changes, hypertension, obesity, depression, and AIDS, the condition of wound healing, prostate cancer, breast cancer, and primary or secondary andrenocortical insufficiency.

Machine--Readable Data Storage Media, and Computer Systems

We have identified a second binding site in the ligand binding domain of NHRs, termed Site II, and provide herein the structure coordinates of Site II. The structure coordinates may be used in the design and identification of ligands of Site IIand modulators of NHRs. In order to so-use structure coordinates, it may be necessary to convert them into a three-dimensional shape. This is achieved through the use of commercially available software that, in conjunction with a computer, is capableof generating three-dimensional graphical representations of molecules or portions thereof from a set of structure coordinates provided on a machine-readable data storage medium.

Therefore, the invention provides a machine-readable data storage medium comprising a data storage material encoded with machine-readable data comprising all or any part of structure coordinates of a Site II, wherein said Site II is a structuredefined by structure coordinates that describe conserved residue backbone atoms having a root mean square deviation of not more than 2.0 .ANG. from the conserved residue backbone atoms described by the structure coordinates of amino acids E537-V543,L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO: 13 according to Table I.

The invention also provides a machine-readable data storage medium comprising a data storage material encoded with machine readable data consisting of all or any part of structure coordinates of a Site II.

As is illustrated in FIG. 3, the cavity circumscribed by Site II and the cavity circumscribed by Site I share a common wall section. That is, some amino acids are common to both Site II and Site I. However the cavity circumscribed by Site II isdistinct from the cavity circumscribed by Site I, as the two cavities are on opposite sides of the common wall. We manually docked dexamethasone into GR Site I (see Example 10) and determined that the following amino acid residues are in contactdistance, i.e. within 2-3 Angstroms, of dexamethasone and thus make up GR Site I: M560, L563, N564, L566, G567, Q570, M601, M604, A605, L608, R611, F623, M639, Q642, M646, L732, Y735, C736, T739 and E748. The following amino acid residues are common toboth GR Site I and Site II: L566, G567, Q570, M601, M604, A605 and R611. The following amino acid residues are unique to GR Site II, i.e. they are not part of GR Site I: E537-V543, V571-W577, S599-W600, F602-L603, F606-A607, W610, R614, Q615, P625,Y663, L664 and K667. The following amino acid residues are unique to GR Site I, i.e. they are not part of GR Site II: M560, L563, N564, L608, F623, M639, Q642, M646, L732, Y735, C736, T739 and E748. The amino acids in other NHRs and non-human GRcorresponding to the above-recited GR amino acids can be seen in FIGS. 2 and 6 respectively. Site II and its function were newly identified by us, who were the first to identify Site II in NHRs as a binding site whose ligands modulate NHRs.

Thus the invention also provides a machine-readable data storage medium comprising a data storage material encoded with machine readable data, wherein the data: (a) comprises all or any part of the structure coordinates of a Site II, wherein saidSite II is a structure defined by structure coordinates that describe conserved residue backbone atoms having a root mean square deviation of not more than 2.0 .ANG. from the conserved residue backbone atoms described by the structure coordinates ofamino acids E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:13 according to Table I; and (b) does not comprise structure coordinates that describe conserved residue backbone atoms having a rootmean square deviation of not more than 2.0 .ANG. from the conserved residue backbone atoms described by the structure coordinates of one or more of amino acids M560, L563, N564, L608, F623, M639, Q642, M646, L732, Y735, C736, T739 and E748 according toTable I. Preferably, said data does not comprise structure coordinates that describe conserved residue backbone atoms having a root mean square deviation of not more than 2.0 .ANG. from the conserved residue backbone atoms described by the structurecoordinates of all of amino acids M560, L563, N564, L608, F623, M639, Q642, M646, L732, Y735, C736, T739 and E748 according to Table I. Preferably, the root mean square deviation of part (b) is less than 1.9, 1.8, 1.7, 1.6 or 1.5 .ANG., more preferablyof less than 1.4, 1.3, 1.2, 1.1, 1.03, 1.02, or 1.0 .ANG., yet more preferably of less than 0.93, 0,92, 0.9, 0.8, 0.7, 0.6 0.5, 0.4, 0.3, 0.2, or 0.1 .ANG., most preferably 1.02, 0.92 or 0.0 .ANG..

The machine-readable data storage media of the present invention are used in a computer. The computer is capable of producing a three-dimensional representation of Site II, and comprises various components, including the machine-readable storagemedium, used to produce the three-dimensional representation.

Thus, the invention further provides a computer system capable of producing a three-dimensional representation of all or any part of a Site II, wherein said computer system comprises: (a) a machine-readable data storage medium comprising a datastorage material encoded with machine readable data comprising all or any part of structure coordinates of Site II, wherein said Site II is a structure defined by structure coordinates that describe conserved residue backbone atoms having a root meansquare deviation of not more than 2.0 .ANG. from the conserved residue backbone atoms described by the structure coordinates of amino acids E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:13according to Table I; (b) a working memory for storing instructions for processing said machine-readable data; (c) a central-processing unit coupled to said working memory and to said machine-readable data storage medium for processing said machinereadable data into said three-dimensional representation; and (d) a display coupled to said central-processing unit for displaying said three-dimensional representation.

The invention also provides a computer system as described above wherein the machine-readable data consists of all or any part of the structure coordinates of Site II.

The invention also provides a computer system capable of producing a three-dimensional representation of all or any part of Site II, wherein said computer system comprises: (a) a machine-readable data storage medium comprising a data storagematerial encoded with machine readable data, wherein the data: (i) comprises all or any part of the structure coordinates of a Site II, wherein said Site II is a structure defined by structure coordinates that describe conserved residue backbone atomshaving a root mean square deviation of not more than 2.0 .ANG. from the conserved residue backbone atoms described by the structure coordinates of amino acids E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667of SEQ ID NO:13 according to Table I; and (ii) does not comprise structure coordinates that describe conserved residue backbone atoms having a root mean square deviation of not more than 2.0 .ANG. from the conserved residue backbone atoms described bythe structure coordinates of one or more of amino acids M560, L563, N564, L608, F623, M639, Q642, M646, L732, Y735, C736, T739 and E748 according to Table I; (b) a working memory for storing instructions for processing said machine-readable data; (c) acentral-processing unit coupled to said working memory and to said machine-readable data storage medium for processing said machine readable data into said three-dimensional representation; and (d) a display coupled to said central-processing unit fordisplaying said three-dimensional representation. Preferably, said data does not comprise structure coordinates that describe conserved residue backbone atoms having a root mean square deviation of not more than 2.0 .ANG. from the conserved residuebackbone atoms described by the structure coordinates of all of amino acids M560, L563, N564, L608, F623, M639, Q642, M646, L732, Y735, C736, T739 and E748 according to Table I.

For all of the present invention, preferably said structure coordinates are Cartesian coordinates, polar coordinates, or internal coordinates. Most preferably said structure coordinates are Cartesian coordinates.

For all of the present invention, preferably said structure coordinates are of at least four amino acids, more preferably of at least five amino acids, more, preferably of at least eight amino acids, more preferably of at least fifteen aminoacids, more preferably of at least twenty amino acids, more preferably at least twenty-five amino acids, most preferably at least thirty amino acids.

For all of the present invention, said structure coordinates may be those determined for a Site II to which a ligand is bound or to which no ligand is bound. Said structure coordinates may be those determined for a Site II of an NHR that is inmonomer, dimer, or other form.

One of ordinary skill in the art will recognize that there can be various embodiments of the components of the computer system. One embodiment of a computer system utilizes System 10 as disclosed in WO 98/11134, the disclosure of which isincorporated herein by reference in its entirety. Briefly, one version of the computer system comprises a central processing unit ("CPU"), a working memory which may be, e.g, RAM (random-access memory) or "core" memory, mass storage memory (such as oneor more disk drives or CD-ROM drives), one or more cathode-ray tube ("CRT") display terminals, one or more keyboards, one or more input lines, and one or more output lines, all of which are interconnected by a conventional bidirectional system bus.

Input hardware, coupled to the computer by input lines, may be implemented in a variety of ways. Machine-readable data of this invention may be inputted via the use of a modem or modems connected by a telephone line or dedicated data line. Alternatively or additionally, the input hardware may comprise CD-ROM drives or disk drives. In conjunction with a display terminal, keyboard may also be used as an input device.

Output hardware, coupled to the computer by output lines, may similarly be implemented by conventional devices. By way of example, output hardware may include a CRT display terminal for displaying a graphical representation of a region or domainof the present invention using a program such as QUANTA as described herein. Output hardware might also include a printer, so that hard copy output may be produced, or a disk drive, to store system output for later use.

In operation, the CPU coordinates the use of the various input and output devices, coordinates data accesses from mass storage, and accesses to and from the working memory, and determines the sequence of data processing steps. A number ofprograms may be used to process the machine-readable data of this invention. Such programs are discussed in reference to the computational methods of drug discovery as described herein. Specific references to components of the hardware system areincluded as appropriate throughout the following description of the data storage medium.

For the purpose of the present invention, any magnetic data storage medium which can be encoded with machine-readable data would be sufficient for carrying out the storage requirements of the system. The medium could be a conventional floppydiskette or hard disk, having a suitable substrate, which may be conventional, and a suitable coating, which may be conventional, on one or both sides, containing magnetic domains whose polarity or orientation could be altered magnetically, for example. The medium may also have an opening for receiving the spindle of a disk drive or other data storage device.

The magnetic domains of the coating of a medium may be polarized or oriented so as to encode in a manner which may be conventional, machine readable data such as that described herein, for execution by a system such as the system describedherein.

Another example of a suitable storage medium which could also be encoded with such machine-readable data, or set of instructions, which could be carried out by a system such as the system described herein, could be an optically-readable datastorage medium. The medium could be a conventional compact disk read only memory (CD-ROM) or a rewritable medium such as a magneto-optical disk which is optically readable and magneto-optically writable. The medium preferably has a suitable substrate,which may be conventional, and a suitable coating, which may be conventional, usually of one side of substrate.

In the case of a CD-ROM, as is well known, the coating is reflective and is impressed with a plurality of pits to encode the machine-readable data. The arrangement of pits is read by reflecting laser light off the surface of the coating. Aprotective coating, which preferably is substantially transparent, is provided on top of the reflective coating.

In the case of a magneto-optical disk, as is well known, the coating has no pits, but has a plurality of magnetic domains whose polarity or orientation can be changed magnetically when heated above a certain temperature, as by a laser. Theorientation of the domains can be read by measuring the polarization of laser light reflected from the coating. The arrangement of the domains encodes the data as described above.

Methods of Designing and Identifying Ligands of Site II and Modulators of NHRs

The present invention permits the use of structure-based or rational drug design and virtual screening to design or identify potential ligands and modulators of Site II.

The identity of Site II as disclosed herein permits the practice of the following techniques commonly practiced in structure-based design and virtual screening.

Using a three-dimensional model of all or any part of Site II, a test molecule, i.e. potential ligand or potential modulator, can be docked into the cavity circumscribed by Site II, i.e. a fitting operation can be performed between a testmolecule and Site II. After docking, the test molecule may be analyzed for structural and chemical feature complementarity with all or any part of Site II. Structural and chemical features include, but are not limited to, any one of the following: vander Waals interactions, hydrogen bonding interactions, charge interaction, hydrophobic interactions, and dipole interactions.

Therefore, the invention provides a method of docking a test molecule comprising docking the test molecule into all or any part of the cavity circumscribed by a Site II, wherein said Site II is a structure defined by structure coordinates thatdescribe conserved residue backbone atoms having a root mean square deviation of not more than 2.0 .ANG. from the conserved residue backbone atoms described by the structure coordinates of amino acids E537-V543, L566, G567, Q570-W577, S599-A607, W610,R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:13 according to Table I. The method may further comprise analyzing structural and chemical feature complementarity of the test molecule with all or any part of said Site II.

A three-dimensional model can be created using methods known in the art, including, but not limited to, using software such as InsightII (Accelrys, Inc., San Diego, Calif.), SYBYL (Tripos Associates, St. Louis, Mo.), and Flo (Colin McMartin,Thistlesoft, Colebrook, Conn.). Docking can be performed manually or using a variety of software, including but not limited to, DOCK (Kuntz et. al. 1982), GOLD (Cambridge Crystallographic Data Center, 12 Union Road, Cambridge, UK), or Flo (Thistlesoft,High Meadow, 603 Colebrook Raod, Colebrook, Conn.). Analyzing structural and chemical feature complementarity includes any process of a) quantifying features of atomic components found within a ligand molecule and protein molecule (eg, charge, size,shape, polarizability, hyprophobicity, etc), and b) quantifying interactions between such features in the ligand molecule, the protein molecule and the protein/ligand complex, as determined using any number of approaches known in the art (eg. molecularmechanics force fields and/or quantum mechanics). Analyzing sturctural and chemical feature complementarity can, for example, be ascertained visually or by scoring functions based on computed ligand-site interactions as implemented in DOCK, GOLD or Flo.

A three dimensional model of Site II can be used to identify structural and chemical features that may be involved in binding of ligands to Site II. Identified structural or chemical features can then be employed to design ligands or modulatorsof Site II or identify test molecules as ligands or modulators of Site II.

Therefore, the invention provides a method of identifying structural and chemical features comprising identifying structural and chemical features of all or any part of a Site II using a three-dimensional model of all or any part of said Site II,wherein said Site II is a structure defined by structure coordinates that describe conserved residue backbone atoms having a root mean square deviation of not more than 2.0 .ANG. from the conserved residue backbone atoms described by the structurecoordinates of amino acids E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:13 according to Table I. Identification of structural and chemical features may be performed by means known in the art,such as through use of DOCK, GOLD or Flo.

Structure-based design often involves modeling. Modeling is the development of a mathematical construct designed to mimic real molecular geometry and behavior in proteins and small molecules. These mathematical constructs include, but are notlimited to: energy calculations for a given geometry of a molecule utilizing forcefields or ab initio methods known in the art; energy minimization using gradients of the energy calculated as atoms are shifted so as to produce a lower energy;conformational searching, ie, locating local energy minima; molecular dynamics wherein a molecular system (single molecule or ligand/protein complex) is propagated forward through increments of time according to Newtonian mechanics using techniques knownto the art; calculations of molecular properties such as electrostatic fields, hydrophobicity and lipophilicity; calculation of solvent-accessible or other molecular surfaces and rendition of the molecular properties on those surfaces; comparison ofmolecules using either atom-atom correspondences or other criteria such as surfaces and properties; quantitiative structure-activity relationships in which molecular features or properties dependent upon them are correlated with activity or bio-assaydata. A number of computer modeling systems are available in which a sequence and structure (i.e., structure coordinates) of a protein or portion of a protein can be input. Examples of such computer modeling systems include, but are not limited to,InsightII (Accelrys, Inc., San Diego, Calif.), SYBYL (Tripos Associates, St. Louis, Mo.), and Flo (Colin McMartin, Thistlesoft, Colebrook, Conn.). The computer system then generates the structural details of one or more regions in which a potentialligand binds so that complementary structural and chemical features of the potential ligands can be determined. Design in these modeling systems is generally based upon the compound being capable of structurally and chemically associating with theprotein, i.e. have structural and chemical feature complementarity. In addition, the compound must be able to assume a conformation that allows it to associate with the protein. Some modeling and design systems estimate the potential inhibitory orbinding effect of a potential modulator prior to actual synthesis and testing. Using modeling, compounds may be designed de novo using an empty binding site. Alternatively, compounds may be designed including some portion of a known ligand, i.e. grownin place. The known ligand may have been determined through virtual screening. Programs for design include, but are not limited to LUDI (Bohm 1992), LeapFrog (Tripos Associates, St. Louis Mo.) and DOCK (Kuntz et. al., 1982).

Therefore, the invention provides a method of designing a ligand of Site II comprising: (a) modeling all or any part of a Site II; and (b) based on said modeling, designing a chemical entity that has structural and chemical featurecomplementarity with all or any part of said Site II; wherein said Site II is a structure defined by structure coordinates that describe conserved residue backbone atoms having a root mean square deviation of not more than 2.0 .ANG. from the conservedresidue backbone atoms described by the structure coordinates of amino acids E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:13 according to Table I. The chemical entity is designed to fitspatially into all or any part of the cavity circumscribed by Site II. The chemical entity may be designed manually without the aid of computer software, either de novo or including some portion of a known ligand. The chemical entity may be designed bycomputer either de novo or including some portion of a known ligand. Design by computer may employ a database from which chemical entities are chosen based on the model. The method may further comprise: (c) docking the chemical entity into all or anypart of the cavity circumscribed by said Site II; and (d) analyzing structural and chemical feature complementarity of the chemical entity with all or any part of said Site II. The method may further comprise analyzing structural and chemical featurecomplementarity of a second chemical entity with all or any part of said Site II, such as when the modeling operation grows a ligand in place.

The invention also provides a method of designing a modulator of an NHR comprising: (a) modeling all or any part of a Site II; and (b) based on said modeling, designing a chemical entity that has structural and chemical feature complementaritywith all or any part of said Site II; wherein said Site II is a structure defined by structure coordinates that describe conserved residue backbone atoms having a root mean square deviation of not more than 2.0 .ANG. from the conserved residue backboneatoms described by the structure coordinates of amino acids E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:13 according to Table I. The chemical entity is designed to fit spatially into all orany part of the cavity circumscribed by said Site II. The chemical entity may be designed manually without the aid of computer software, either de novo or including some portion of a known ligand. The chemical entity may be designed by computer eitherde novo or including some portion of a known ligand. Design by computer may employ a database from which chemical entities are chosen based on the model. The method may further comprise: (c) docking the chemical entity into all or any part of thecavity circumscribed by said Site II; and (d) analyzing structural and chemical feature complementarity of the chemical entity with all or any part of said Site II. The method may further comprise analyzing structural and chemical featurecomplementarity of a second chemical entity with all or any part of said Site II, such as when the modeling operation grows a ligand in place.

Virtual screening methods, i.e. methods of evaluating the potential of chemical entities to bind to a given protein or portion of a protein, are well known in the art. These methods often utilize databases as sources of the chemical entities andoften are employed in designing ligands. Often these methods begin by visual inspection of the binding site on the computer screen. Selected chemical entities can then be placed, i.e. docked, in one or more positions and orientations within the bindingsite and chemical and structural feature complementarity can be analyzed.

In virtual screening, molecular docking can be accomplished using software such as InsightII, ICM (Molsoft LLC, La Jolla, Calif.), and SYBYL, followed by energy minimization and molecular dynamics with standard molecular mechanics forcefieldssuch as CHARMM and MMFF. Examples of computer programs which assist in the selection of chemical entities useful in the present invention include, but are not limited to, GRID (Goodford, 1985), AUTODOCK (Goodsell, 1990), and DOCK (Kuntz et. al. 1982). Databases of chemical entities that may be used include, but are not limited to, ACD (Molecular Designs Limited), Aldrich (Aldrich Chemical Company), NCI (National Cancer Institute), Maybridge (Maybridge Chemical Company Ltd), CCDC (CambridgeCrystallographic Data Center), CAST (Chemical Abstract Service) and Derwent (Derwent Information Limited).

For example, programs such as DOCK (Kuntz et. al 1982) can be used with the structure coordinates of Site II to identify chemical entities from databases or virtual databases of small molecules. These molecules may therefore be suitablecandidates for synthesis and testing. Such a virtual screening approach may include, but is not limited to, the following steps: 1) Selection of a chemical entity from a database or elsewhere and positioning the chemical entity in one or moreorientations within all or any part of the cavity circumscribed by Site II, wherein Site II is a structure defined by structure coordinates that describe conserved residue backbone atoms having a root mean square deviation of not more than 2.0 .ANG. from the conserved residue backbone atoms described by the structure coordinates of amino acids E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:13 according to Table I. 2) Characterization ofthe structural and chemical features of the chemical entity and binding site, such as van der Waals interactions, hydrogen bonding interactions, charge interaction, hydrophobic bonding interaction, and dipole interactions 3) Optionally, selection from adatabase or elsewhere of a chemical entity which can be joined to or replace the docked chemical entity and fit spatially into all or any part of the cavity circumscribed by Site II 4) Evaluation of the docked chemical entity using a combination ofscoring schemes which account for van der Waals interactions, hydrogen bonding interactions, charge interaction and hydrophobic interactions, i.e. evaluation of structural and chemical feature complementarity.

Upon selection of preferred chemical entities, their relationship to each other and Site II can be visualized and then assembled into a single potential ligand. Programs useful in assembling the individual chemical entities include, but are notlimited to, SYBYL and LeapFrog (Tripos Associates, St. Louis Mo.), LUDI (Bohm 1992) and 3D Database systems (Martin 1992).

Thus the invention provides a method for evaluating the potential of a chemical entity to bind to all or any part of Site II comprising: a) docking a chemical entity into all or any part of the cavity circumscribed by a Site II, wherein said SiteII is a structure defined by structure coordinates that describe conserved residue backbone atoms having a root mean square deviation of not more than 2.0 .ANG. from the conserved residue backbone atoms described by the structure coordinates of aminoacids E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:13 according to Table I; and b) analyzing structural and chemical feature complementarity between the chemical entity and all or any part ofsaid Site II. The chemical entity may be selected from a database. The method may further comprise a step in which a second chemical entity is joined to the first chemical entity that was docked and analyzed, and the resultant chemical entity is dockedand analyzed.

Ligands designed or identified using the methods described herein can then be synthesized and screened in an NHR Site II binding assay (such as is described in Examples 15 and 18), or in an assay designed to test functional activity (such as thecellular tranrepressional assay described in Example 3 and the cellular transcriptional assay described in Example 4, and the competition assays described in Examples 11 and 12). Examples of assays useful in screening of potential ligands or modulatorsinclude, but are not limited to, screening in silico, in vitro assays and high throughput assays.

Similarly and further to the method for evaluating the potential of a chemical entity to bind Site II, test molecules may be screened, using computational means and biological assays, to identify ligands of Site II and modulators of NHRs.

Thus, the invention provides a method for identifying a modulator of an NHR. The method comprises the following steps, which are preferably, but not necessarily, performed in the order given: a) docking a test molecule into all or any part ofthe cavity circumscribed by a Site II, wherein said Site II is a structure defined by structure coordinates that describe conserved residue backbone atoms having a root mean square deviation of not more than 2.0 .ANG. from the conserved residue backboneatoms described by the structure coordinates of amino acids E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:13 according to Table I; b) analyzing structural and chemical feature complementaritybetween the test molecule and all or any part said Site II; and c) screening the test molecule in a biological assay of modulation of an NHR. A test molecule is identified as a modulator of an NHR if the structural and chemical feature complementarityand/or the modulation exceed a desired level. A compound which stimulates or inhibits a measured activity in a cellular assay by greater than 10% is a preferred modulator. The method may further comprise one or more of the following steps: d) screeningthe test molecule in an assay that characterizes binding to a Site II; and e) screening the test molecule in an assay that characterizes binding to Site I.

A biological assay of modulation of an NHR includes, but is not limited to: a transrepression assay, such as described in Example 3; a transactivation assay, such as described in Example 4; a transrepression competition assay, such as describedin Example 11; and a transactivation competition assay, such as described in Example 12. An assay that characterizes binding to Site II includes, but is not limited to, any of the assays described in Examples 15 and 18.

The invention provides a method for identifying a ligand of Site II. The method comprises the following steps, which are preferably, but not necessarily, performed in the order given: a) docking a test molecule into all or any part of the cavitycircumscribed by a Site II, wherein said Site II is a structure defined by structure coordinates that describe conserved residue backbone atoms having a root mean square deviation of not more than 2.0 .ANG. from the conserved residue backbone atomsdescribed by the structure coordinates of amino acids E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:13 according to Table I; b) analyzing structural and chemical feature complementaritybetween the test molecule and all or any part said Site II; and c) screening the test molecule in an assay that characterizes binding to a Site II. A test molecule that binds to Site II is identified as a ligand of Site II. The method may furthercomprise one or more of the following steps: d) screening the test molecule in a biological assay of modulation of an NHR; and e) screening the test molecule in an assay that characterizes binding to Site I.

In the above-described method of identifying a modulator of an NHR and method of identifying a ligand of Site II, the structure coordinates of a Site II of a first NHR may be used, while the biological assays (i.e. biological assay of modulationof an NHR, or assay that characterizes binding to Site II, or assay that characterizes binding to Site I) may be performed using a second NHR. Preferably, the structure coordinates of a Site II are of the same NHR as the NHR used in the biologicalassays.

In the present methods, a modulator of an NHR can induce one or more of the following four activities in the NHR. This list is not meant to be inclusive. (1) A modulator of an NHR can induce transrepression. (2) A modulator of an NHR caninduce transactivation. (3) A modulator of an NHR can inhibit or antagonize the ability of another modulator from inducing transrepression. (4) A modulator of an NHR can inhibit or antagonize the ability of another modulator from inducingtransactivation.

Preferably said modulator of an NHR is a modulator of an SHR, more preferably a modulator of GR.

A modulator of an NHR, SHR or GR that induces transrepression includes, but is not limited to, a dissociated compound.

Preferably said modulator of an NHR induces transrepression. More preferably said modulator of an NHR is a dissociated compound. More preferably said modulator of an NHR is an SHR dissociated compound. Most preferably said modulator of an NHRis a GR dissociated compound.

"All or any part of the cavity circumscribed by Site II" preferably relates to enough of the cavity so as to be useful in docking or modeling a ligand into the cavity. Preferably, all or any part of the cavity is circumscribed by one or more ofthe following residues: E537-V543, V571-W577, S599-W600, F602-L603, F606-A607, W610, R614, Q615, P625, Y663, L664 and K667. These are the residues of Site II that are not also part of Site I. Preferably, all or any part of the cavity is circumscribed byat least four amino acid residues, more preferably at least five amino acids, more preferably at least eight amino acid residues, more preferably at least fifteen amino acid residues, more preferably at least twenty amino acid residues, more preferablyat least twenty-five amino acid residues, most preferably at least thirty amino acid residues.

The structure coordinates of Site II of a first NHR may be used in the above methods when one is interested in a second NHR. For instance, one may use the structure coordinates of GR Site II in a method when the end goal is to evaluate thepotential of a chemical entity to bind to Site II of another NHR, for instance, androgen receptor. This is because, based on the structural similarity amongst various NHRs, it is possible that a modulator of GR Site II, or structural variants of amodulator of GR Site II, could bind to Site II in other NHRs. It is known in the art that a single steroid can bind to multiple NHRs. For example, cortisol can bind not only to GR but to the mineralocorticoid receptor as well. It is thought that thisbinding of cortisol occurs via Site I.

Ligands of Site II, and Modulators of NHRs

We have identified Site II in NHRs and identified ligands of Site II as modulators of NHRs and thus drug candidates.

Therefore, the invention provides a ligand of a Site II, wherein said Site II is a structure defined by structure coordinates that describe conserved residue backbone atoms having a root mean square deviation of not more than 2.0 .ANG. from theconserved residue backbone atoms described by the structure coordinates of amino acids E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:13 according to Table I.

A ligand can be identified by any art-recognized assay for binding to Site II, such as the assays described in Examples 15 and 18.

Preferred ligands have been identified according to a method of the invention described herein. That is, preferred ligands were identified by a method comprising: a) docking a test molecule into all or any part of the cavity circumscribed by aSite II, wherein said Site II is a structure defined by structure coordinates that describe conserved residue backbone atoms having a root mean square deviation of not more than 2.0 .ANG. from the conserved residue backbone atoms described by thestructure coordinates of amino acids E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:13 according to Table I; b) analyzing the structural and chemical feature complementarity between the testmolecule and all or any part said Site II; and c) screening the test molecule in an assay that characterizes binding to a Site II. A test molecule that binds to Site II is identified as a ligand of Site II. The method may further comprise one or moreof the following steps: d) screening the test molecule in a biological assay of modulation of an NHR; and e) screening the test molecule in an assay that characterizes binding to Site I.

Preferred ligands are ligands of an NHR Site II, more preferably of an SHR Site II, most preferably of a GR Site II.

The invention also provides a modulator of an NHR identified according to a method of the invention described herein. That is, the invention provides a modulator of an NHR, wherein said modulator has been identified by a method comprising: a)docking a test molecule into all or any part of the cavity circumscribed by a Site II, wherein said Site II is a structure defined by structure coordinates that describe conserved residue backbone atoms having a root mean square deviation of not morethan 2.0 .ANG. from the conserved residue backbone atoms described by the structure coordinates of amino acids E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:13 according to Table I; b)analyzing the structural and chemical feature complementarity between the test molecule and all or any part said Site II; and c) screening the test molecule in a biological assay of modulation of an NHR. A test molecule is identified as a modulator ofan NHR if the structural and chemical feature complementarity and the modulation exceed a desired level. The method may further comprise one or more of the following steps: d) screening the test molecule in an assay that characterizes binding to a SiteII; and e) screening the test molecule in an assay that characterizes binding to Site I.

Preferably said modulator of an NHR is a ligand of Site II. Preferred modulators are modulators of an NHR, more preferably of an SHR, most preferably of a GR.

The invention also provides a modulator of an NHR that is a ligand of a Site II. A modulator of an NHR that is a ligand of Site II is part of the invention regardless of how the modulator was identified.

As previously stated, the term "modulator," as used herein, refers to a molecule whose presence induces an activity in the molecule that it modulates. The following information on modulators applies to all of the present inventions.

A modulator can bind to the molecule that it modulates, i.e. be a ligand of the molecule it modulates. A preferred modulator is a ligand of the molecule that it modulates. In the present inventions, a preferred modulator is a ligand of Site II. Modulators include, but are not limited to, small organic molecules, chemical compounds, peptides, peptidomimetics (eg., cyclic peptides, peptide analogs, or constrained peptides) and nucleic acids. Modulators can be natural or synthetic. Preferredmodulators are small organic molecules.

A modulator of an NHR can induce one or more of the following four activities in the NHR. This list is not meant to be inclusive. (1) A modulator of an NHR can induce transrepression. (2) A modulator of an NHR can induce transactivation. (3)A modulator of an NHR can inhibit or antagonize the ability of another modulator from inducing transrepression. (4) A modulator of an NHR can inhibit or antagonize the ability of another modulator from inducing transactivation.

One type of modulator of an NHR is one that induces transrepression. Examples of this type of modulator are steroids (such as glucocorticoids and dexamethasone) and dissociated compounds, both of which are discussed further below. Several suchmodulators are described in the Examples. Such a modulator is useful in treating inflammatory and immune associated diseases and disorders. A modulator that induces tranrespression and synergizes (i.e. has an additive effect) with another modulatorthat induces transrepression, such as described in Examples 11 and 17, is included in the definition of a modulator that induces transrepression.

Another type of modulator is a dissociated compound. A dissociated compound is a modulator that induces transrepression while inducing none or minimal transactivation. That is, a dissociated compound induces activity (1) above but induces no orlittle activity (2) above. Several such modulators are described in the Examples. A dissociated compound also may inhibit or antagonize the ability of another modulator from causing transactivation, i.e. a dissociated compound may cause activity (4)above, such as the compound described in Examples 11 and 12, Dissociated compounds that induce AP-1 and NF-.kappa.B inhibitory activity without causing DNA-binding activity are useful in treating inflammatory and immune associated diseases and disorders,such as in immunosuppressive therapy. AP-1 and NF-.kappa.B are transcription factors which regulate the expression of a large number of genes involved in immune and inflammatory responses. These genes include TNF-alpha, IL-2, IL-5, E-selectin,Eoxtaxin, Rantes, Cox-2, among others. By way of example, glucocorticoids, which inhibit the activity of both AP-1 and NF-.kappa.B are one of the most potent anti-inflammatory drugs known to date. Glucocorticoids are used to treat more than 50diseases, however, their use in patients is often limited by the side effects of osteoporosis, diabetes, glaucoma, muscle loss, facial swelling, personality changes, and others. It is thought that a compound which inhibits NF-.kappa.B and AP-1 withoutinducing DNA binding (i.e. without causing transactivation) would possess most of the anti-inflammatory effects of glucocorticoids without the side effects.

Another type of modulator of is one that induces transactivation without inducing transrepression. In the case of GR, such a modulator that induces DNA binding and transcription may be useful in treating Addison's disease or other metabolicdisorders where circulating glucocorticoid levels are lower than normal and where causing transrepression is not desireable.

Another type of modulator is one that induces both transrepression and transactivation. Examples of this type of modulator are steroids such as glucocorticoids and dexamethasone. Such a modulator is useful in treating inflammatory and immuneassociated diseases and disorders.

Another type of modulator is one that antagonizes a modulator that induces transactivation. These modulators inhibit transcription. Such a modulator is described in Example 12. These modulators may also induce transrepression. In the case ofGR, a modulator that antagonizes a modulator that induces transactivation may be useful in treating metabolic diseases such as diabetes, hypertension, obesity, glaucoma, depression, and AIDS, and in wound healing. It is believed that some of thesediseases are, at least in part, caused by higher than normal circulating levels of glucocorticoids. Inhibiting the transactivation or DNA binding induced by the increased circulating glucocorticoids may ameliorate or attenuate some or all of thesediseases. Preferably, the GR modulator that antagonizes a modulator that induces transactivation does not also induce transrepression.

All modulators of NHRs and ligands of Site II may be useful in elucidating the mechanism of transcriptional regulation mediated by NHRs. These modulators and ligands could be used in cellular and animal studies to determine the requirement forNHRs in the induction or inhibition of gene expression, the association of coactivators and corepressors with NHRs, and the role of chaperones in regulating NHR activity, among other experiments.

Modulators of NHRs may be found by performing any art-recognized transrepression assay, transactivation assay, transrepression competition assay, or transactivation competition assay. Such assays include, but are not limited to, the assaysdescribed in Examples 3, 4, 11 and 12.

For a modulator of an NHR that induces transrepression, such as and including a dissociated compound, a preferred modulator induces transrepression at an IC50 of between 0.1 nM and 10 .mu.M, more preferably between 0.1 nm and 1 .mu.M (such asbetween 33 nM and 275 nM, or between 15 nm and 275 nm), more preferably between 0.1 nM and 100 nM, most preferably between 0.1 nM and 10 nM. Transrepression may be measured by any art-recognized method, such as the cellular transrepressional assaysdescribed in Example 3. An IC50 is the modulator concentration which causes a 50% repression of transcription.

For a modulator of an NHR that induces none to minimal transactivation, such as and including a dissociated compound, a preferred modulator induces transactivation at an EC50 of greater than 1M, preferably at greater than 100 nM, more preferablyat greater than 1 .mu.M, and most preferably at greater than 40 .mu.M. Transactivation may be measured by any method known in the art, such as the cellular transcriptional assays described in Example 4. An EC50 is modulator concentration required tocause a 50% stimulation of transcription.

For a dissociated compound, a preferred dissociated compound has a dissociation constant of greater than 0.1, more preferably greater than 10, more preferably greater than 100 (such as between 167 and 1000, or between 137 and 1000), mostpreferably greater than 1000. The dissociation constant is calculated by dividing the EC50 for transactivation by the IC50 for transrepression.

For a modulator of an NHR that antagonizes a modulator that induces transactivation, a preferred modulator antagonizes at an IC50 of between 0.1 nM and 10 .mu.M, more preferably between 0.1 nM and 1 .mu.M, more preferably between 0.1 nM and 100nM, most preferably between 0.1 nM and 10 nM.

For a modulator of an NHR that induces transactivation, a preferred modulator induces transactivation at an IC50 of between 0.1 nM and 10 .mu.M, more preferably between 0.1 nM and 1 .mu.M, more preferably between 0.1 nM and 100 nM, mostpreferably between 0.1 nM and 10 nM.

Methods of Modulating a Nuclear Hormone Receptor

The modulators of the present invention may be used to modulate an NHR.

Thus, the invention provides a method of modulating an NHR comprising administering a modulator of an NHR in an amount sufficient to modulate the NHR, wherein said modulator of an NHR is a ligand of a Site II or was identified by a methodcomprising: a) docking a test molecule into all or any part of the cavity circumscribed by a Site II, wherein said Site II is a structure defined by structure coordinates that describe conserved residue backbone atoms having a root mean square deviationof not more than 2.0 .ANG. from the conserved residue backbone atoms described by the structure coordinates of amino acids E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:13 according to TableI; b) analyzing the structural and chemical feature complementarity structural and chemical feature complementarity between the test molecule and all or any part said Site II; and c) screening the test molecule in a biological assay of modulation of anNHR. A test molecule is identified as a modulator of an NHR if the structural and chemical feature complementarity and the modulation exceed a desired level. The method may further comprise one or more of the following steps: d) screening the testmolecule in an assay that characterizes binding to a Site II; and e) screening the test molecule in an assay that characterizes binding to Site I.

The invention provides a method of inducing transrepression comprising administering a modulator of an NHR in an amount sufficient to cause transrepression, wherein said modulator on an NHR is a ligand of Site II or was identified by the methoddescribed above.

The invention provides a method of inhibiting AP-1-dependent gene expression comprising administering a modulator of an NHR in an amount sufficient to inhibit AP-1-dependent gene expression, wherein said modulator on an NHR is a ligand of Site IIor was identified by the method described above.

The invention provides a method of inhibiting NF-.kappa.B-dependent gene expression comprising administering a modulator of an NHR in an amount sufficient to inhibit NF-.kappa.B-dependent gene expression, wherein said modulator on an NHR is aligand of Site II or was identified by the method described above.

The invention provides a method of antagonizing transactivation comprising administering a modulator of an NHR in an amount sufficient to antagonize transactivation, wherein said modulator on an NHR is a ligand of Site II or was identified by themethod described above.

Preferred ligands used in the methods of the present invention were identified by a method comprising: a) docking a test molecule into all or any part of the cavity circumscribed by a Site II, wherein said Site II is a structure defined bystructure coordinates that describe conserved residue backbone atoms having a root mean square deviation of not more than 2.0 .ANG. from the conserved residue backbone atoms described by the structure coordinates of amino acids E537-V543, L566, G567,Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:13 according to Table I; b) analyzing the structural and chemical feature complementarity between the test molecule and all or any part said Site II; and c) screeningthe test molecule in an assay that characterizes binding to a Site II. A test molecule that binds to Site II is identified as a ligand of Site II. The method may further comprise one or more of the following steps: d) screening the test molecule in abiological assay of modulation of an NHR; and e) screening the test molecule in an assay that characterizes binding to Site I.

The methods may be practiced in vitro or in vivo. When practiced in vitro, the method may employ any number of art-recognized in vitro systems, including the assays described in Examples 3 and 4. In vivo methods include, but are not limited to,any of the ways described in the section below on methods of treatment.

Pharmaceutical Compositions

The invention provides a pharmaceutical composition comprising: (a) a modulator of an NHR that was identified by a method comprising: (i) docking a test molecule into all or any part of the cavity circumscribed by a Site II, wherein said Site IIis a structure defined by structure coordinates that describe conserved residue backbone atoms having a root mean square deviation of not more than 2.0 .ANG. from the conserved residue backbone atoms described by the structure coordinates of amino acidsE537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:13 according to Table I; (ii) analyzing the structural and chemical feature complementarity between the test molecule and all or any part saidSite II; and (iii) screening the test molecule in a biological assay of modulation of an NHR; and (b) a pharmaceutically acceptable carrier, adjuvant, excipient or vehicle. A test molecule is identified as a modulator of an NHR if the structural andchemical feature complementarity and the modulation exceed a desired level. The method used to identify a modulator of Site II may further comprise one or more of the following steps: d) screening the test molecule in an assay that characterizes bindingto a Site II; and e) screening the test molecule in an assay that characterizes binding to Site I.

The invention provides a pharmaceutical composition comprising a modulator of an NHR that is a ligand of Site II and a pharmaceutically acceptable carrier, adjuvant, excipient or vehicle. Preferred ligands of Site II were identified by a methodcomprising: a) docking a test molecule into all or any part of the cavity circumscribed by a Site II, wherein said Site II is a structure defined by structure coordinates that describe conserved residue backbone atoms having a root mean square deviationof not more than 2.0 .ANG. from the conserved residue backbone atoms described by the structure coordinates of amino acids E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:13 according to TableI; b) analyzing the structural and chemical feature complementarity between the test molecule and all or any part said Site II; and c) screening the test molecule in an assay that characterizes binding to a Site II. A test molecule that binds to Site IIis identified as a ligand of Site II. The method may further comprise one or more of the following steps: d) screening the test molecule in a biological assay of modulation of an NHR; and e) screening the test molecule in an assay that characterizesbinding to Site I.

In the present pharmaceutical compositions, a modulator of an NHR can induce one or more of the following four activities in the NHR. This list is not meant to be inclusive. (1) A modulator of an NHR can induce transrepression. (2) A modulatorof an NHR can induce transactivation. (3) A modulator of an NHR can inhibit or antagonize the ability of another modulator from inducing transrepression. (4) A modulator of an NHR can inhibit or antagonize the ability of another modulator from inducingtransactivation.

Preferably said modulator of an NHR is a modulator of an SHR, more preferably a modulator of GR.

A modulator of an NHR, SHR or GR that induces transrepression includes, but is not limited to, a dissociated compound.

Preferably said modulator of an NHR induces transrepression. More preferably said modulator of an NHR is a dissociated compound. More preferably said modulator of an NHR is an SHR dissociated compound. Most preferably said modulator of an NHRis a GR dissociated compound.

The pharmaceutical composition may further comprise at least one additional therapeutic agent. "Additional therapeutic agents" encompasses, but is not limited to, an agent or agents selected from the group consisting of an immunosuppressant, ananti-cancer agent, an anti-viral agent, an anti-inflammatory agent, an anti-fungal agent, an antibiotic, an anti-vascular hyperproliferation compound, an anti-diabetic agent, or an anti-depressant agent.

The term "pharmaceutically acceptable carrier, adjuvant or vehicle" refers to a carrier, adjuvant or vehicle that may be administered to a subject, together with a modulator of the present invention, and which does not destroy the pharmacologicalactivity thereof. Pharmaceutically acceptable carriers, adjuvants and vehicles that may be used in the pharmaceutical compositions of the present invention include, but are not limited to, the following: ion exchangers, alumina, aluminum stearate,lecithin, self-emulsifying drug delivery systems ("SEDDS") such as d(-tocopherol polyethyleneglycol 1000 succinate), surfactants used in pharmaceutical dosage forms such as Tweens or other similar polymeric delivery matrices, serum proteins such as humanserum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes such as protamine sulfate, disodium hydrogen phosphate, potassiumhydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethylcellulose, polyacrylates, waxes, polyethylene-polyoxypropylene-blockpolymers, polyethylene glycol and wool fat. Cyclodextrins such as .alpha.-, .beta.- and .gamma.-cyclodextrin, or chemically modified derivatives such as hydroxyalkylcyclodextrins, including 2- and 3-hydroxypropyl-.beta.-cyclodextrins, or othersolubilized derivatives may also be used to enhance delivery of the modulators of the present invention.

The compositions of the present invention may contain other therapeutic agent(s) as described below, and may be formulated, for example, by employing conventional solid or liquid vehicles or diluents, as well as pharmaceutical additives of a typeappropriate to the mode of desired administration (for example, excipients, binders, preservatives, stabilizers, flavors, etc.) according to techniques such as those well known in the art of pharmaceutical formulation.

The modulators may be administered by any suitable means, for example, orally, such as in the form of tablets, capsules, granules or powders; sublingually; buccally; parenterally, such as by subcutaneous, intravenous, intramuscular, orintrasternal injection or infusion techniques (e.g., as sterile injectable aqueous or non-aqueous solutions or suspensions); nasally such as by inhalation spray; topically, such as in the form of a cream or ointment; or rectally such as in the form ofsuppositories; in dosage unit formulations containing non-toxic, pharmaceutically acceptable vehicles or diluents. The present modulators may, for example, be administered in a form suitable for immediate release or extended release. Immediate releaseor extended release may be achieved by the use of suitable pharmaceutical compositions comprising the present modulators, or, particularly in the case of extended release, by the use of devices such as subcutaneous implants or osmotic pumps. The presentmodulators may also be administered liposomally.

Exemplary compositions for oral administration include suspensions which may contain, for example, microcrystalline cellulose for imparting bulk, alginic acid or sodium alginate as a suspending agent, methylcellulose as a viscosity enhancer, andsweeteners or flavoring agents such as those known in the art; and immediate release tablets which may contain, for example, microcrystalline cellulose, dicalcium phosphate, starch, magnesium stearate and/or lactose and/or other excipients, binders,extenders, disintegrants, diluents and lubricants such as those known in the art. The present modulators may also be delivered through the oral cavity by sublingual and/or buccal administration. Molded tablets, compressed tablets or freeze-driedtablets are exemplary forms which may be used. Exemplary compositions include those formulating the present modulator(s) with fast dissolving diluents such as mannitol, lactose, sucrose and/or cyclodextrins. Also included in such formulations may behigh molecular weight excipients such as celluloses (avicel) or polyethylene glycols (PEG). Such formulations may also include an excipient to aid mucosal adhesion such as hydroxy propyl cellulose (HPC), hydroxy propyl methyl cellulose (HPMC), sodiumcarboxy methyl cellulose (SCMC), maleic anhydride copolymer (e.g., Gantrez), and agents to control release such as polyacrylic copolymer (e.g., Carbopol 934). Lubricants, glidants, flavors, coloring agents and stabilizers may also be added for ease offabrication and use.

Exemplary compositions for nasal aerosol or inhalation administration include solutions in saline which may contain, for example, benzyl alcohol or other suitable preservatives, absorption promoters to enhance bioavailability, and/or othersolubilizing or dispersing agents such as those known in the art.

Exemplary compositions for parenteral administration include injectable solutions or suspensions which may contain, for example, suitable non-toxic, parenterally acceptable diluents or solvents, such as mannitol, 1,3-butanediol, water, Ringer'ssolution, an isotonic sodium chloride solution, or other suitable dispersing or wetting and suspending agents, including synthetic mono- or diglycerides, and fatty acids, including oleic acid. The term "parenteral" as used herein includes subcutaneous,intracutaneous, intravenous, intramuscular, intraarticular, intraarterial, intrasynovial, intrastemal, intrathecal, intralesional and intracranial injection or infusion techniques.

Exemplary compositions for rectal administration include suppositories which may contain, for example, a suitable non-irritating excipient, such as cocoa butter, synthetic glyceride esters or polyethylene glycols, which are solid at ordinarytemperatures, but liquify and/or dissolve in the rectal cavity to release the drug.

Exemplary compositions for topical administration include a topical carrier such as Plastibase (mineral oil gelled with polyethylene).

The effective amount of a modulator of the present invention may be determined by one of ordinary skill in the art, and includes exemplary dosage amounts for an adult human of from about 0.1 to 500 mg/kg of body weight of active modulator perday, which may be administered in a single dose or in the form of individual divided doses, such as from 1 to 5 times per day. It will be understood that the specific dose level and frequency of dosage for any particular subject may be varied and willdepend upon a variety of factors including the activity of the specific modulator employed, the metabolic stability and length of action of that modulator, the species, age, body weight, general health, sex and diet of the subject, the mode and time ofadministration, rate of excretion, drug combination, and severity of the particular condition. Preferred subjects for treatment include animals, most preferably mammalian species such as humans, and domestic animals such as dogs, cats and the like,subject to NHR-associated diseases.

The modulators of the present invention may be employed alone or in combination with each other and/or other suitable therapeutic agent(s) useful in the treatment of NHR-associated diseases, such as immunosuppressants, anti-cancer agents,anti-viral agents, anti-inflammatory agents, anti-fungal agents, antibiotics, anti-vascular hyperproliferation agents, anti-diabetic agents, or anti-depressant agents. Such other therapeutic agent(s) may be administered prior to, simultaneously with orfollowing the administration of the compound(s) of the present invention.

Exemplary such other therapeutic agents include the following: cyclosporins (e.g., cyclosporin A), CTLA4-Ig, antibodies such as anti-TNF-.alpha. (such as Remicade), anti-ICAM-3, anti-IL-2 receptor (Anti-Tac), anti-CD45RB, anti-CD2, anti-CD3(OKT-3), anti-CD4, anti-CD80, anti-CD86, monoclonal antibody OKT3, agents blocking the interaction between CD40 and CD154 (a.k.a. "gp39"), such as antibodies specific for CD40 and/or CD 154, fusion proteins constructed from CD40 and/or CD154/gp39 (e.g.,CD40Ig and CD8gp39), inhibitors, such as nuclear translocation inhibitors, of NF-.kappa.B function, such as deoxyspergualin (DSG), non-steroidal antiinflammatory drugs (NSAIDs) such as ibuprofen, celecoxib, rofecoxib, cox-2 inhibitors, and aspirin,antibiotics such as penicillin, and tetracycline, steroids such as prednisone or dexamethasone, gold compounds, antiviral agents such as abacavir, antiproliferative agents such as mycophenolate, 5-fluorouracil, cisplatin, methotrexate, leflunomide, FK506(tacrolimus, Prograf), cytotoxic drugs such as azathiprine and cyclophosphamide, TNF-.alpha. inhibitors such as tenidap, anti-TNF antibodies (such as Remicade) or soluble TNF receptor (such as Enbrel), and rapamycin (sirolimus or Rapamune) orderivatives thereof. The above other therapeutic agents, when employed in combination with the modulators of the present invention, may be used, for example, in those amounts indicated in the Physicians' Desk Reference (PDR) or as otherwise determinedby one of ordinary skill in the art.

Methods of Treatment

The modulators of the present invention may be used to treat diseases.

The present invention provides a method of treating an NHR-associated disease comprising administering to a subject in need thereof, in an amount effective therefore, at least one modulator of an NHR, wherein said modulator of an NHR wasidentified by the method comprising: a) docking a test molecule into all or any part of the cavity circumscribed by a Site II, wherein said Site II is a structure defined by structure coordinates that describe conserved residue backbone atoms having aroot mean square deviation of not more than 2.0 .ANG. from the conserved residue backbone atoms described by the structure coordinates of amino acids E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQID NO:13 according to Table I; b) analyzing the structural and chemical feature complementarity between the test molecule and all or any part said Site II; and c) screening the test molecule in a biological assay of modulation of an NHR. A test moleculeis identified as a modulator of an NHR if the structural and/or chemical feature complementarity and the modulation exceed a desired level. The method may further comprise one or more of the following steps: d) screening the test molecule in an assaythat characterizes binding to a Site II; and e) screening the test molecule in an assay that characterizes binding to Site I.

The present invention provides a method of treating an NHR-associated disease comprising administering to a subject in need thereof, in an amount effective therefore, at least one modulator of an NHR that is a ligand of a Site II.

Preferably said NHR-associated disease is an SHR-associated disease and said modulator of an NHR is a modulator of an SHR. Most preferably said NHR-associated disease is a GR-associated disease and said modulator of an NHR is a modulator of GR.

The present invention provides a method of treating a disease associated with NHR transactivation comprising administering to a subject in need thereof, in an amount effective therefore, at least one modulator of an NHR, wherein said modulator ofan NHR was identified by the method described above.

The present invention provides a method of treating a disease associated with NHR transactivation comprising administering to a subject in need thereof, in an amount effective therefore, at least one modulator of an NHR that is a ligand of a SiteII.

The present invention provides a method of treating a disease associated with NHR transrepression comprising administering to a subject in need thereof, in an amount effective therefore, at least one modulator of an NHR, wherein said modulator ofan NHR was identified by the method described above.

The present invention provides a method of treating a disease associated with NHR transrepression comprising administering to a subject in need thereof, in an amount effective therefore, at least one modulator of an NHR that is a ligand of aSite.

The invention provides a method of treating a disease associated with AP-1-dependent gene expression or NF-.kappa.B-dependent gene expression comprising administering to a subject in need thereof, in an amount effective therefore, at least onemodulator of an NHR, wherein said modulator of an NHR was identified by the method described above.

The invention provides a method of treating a disease associated with AP-1-dependent gene expression or NF-.kappa.B-dependent gene expression comprising administering to a subject in need thereof, in an amount effective therefore, at least onemodulator of an NHR that is a ligand of a Site II.

The invention provides a method of treating an inflammatory or immune associated disease or disorder comprising administering to a subject in need thereof, in an amount effective therefore, at least one modulator of an NHR, wherein said modulatorof an NHR was identified by the method described above.

The invention provides a method of treating an inflammatory or immune disease or disorder comprising administering to a subject in need thereof, in an amount effective therefore, at least one modulator of an NHR that is a ligand of a Site II.

Preferably said methods of treating an inflammatory or immune disease or disorder comprise inhibiting AP-1-dependent gene expression or NF-.kappa.B-dependent gene expression by administering said modulator of an NHR in an amount effective toinhibit AP-1-dependent gene expression or NF-.kappa.B-dependent gene expression.

The present invention provides a method of treating a disease treatable by inducing NHR transrepression comprising administering to a subject in need thereof, in an amount effective therefore, at least one modulator of an NHR that inducestransrepression, wherein said modulator of an NHR was identified by the method described above.

The present invention provides a method of treating a disease treatable by inducing NHR transrepression comprising administering to a subject in need thereof, in an amount effective therefore, at least one modulator of an NHR that inducestransrepression, wherein said modulator of an NHR is a ligand of a Site II.

The present invention provides a method of treating a disease treatable by antagonizing NHR transactivation comprising administering to a subject in need thereof, in an amount effective therefore, at least one modulator of an NHR that antagonizestransactivation, wherein said modulator of an NHR was identified by the method described above.

The present invention provides a method of treating a disease treatable by antagonizing NHR transactivation comprising administering to a subject in need thereof, in an amount effective therefore, at least one modulator of an NHR that antagonizestransactivation, wherein said modulator of an NHR is a ligand of a Site II.

Preferred ligands of Site II used in the present methods of treatment were identified by a method comprising: a) docking a test molecule into all or any part of the cavity circumscribed by a Site II, wherein Site II is a structure defined bystructure coordinates that describe conserved residue backbone atoms having a root mean square deviation of not more than 2.0 .ANG. from the conserved residue backbone atoms described by the structure coordinates of amino acids E537-V543, L566, G567,Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:13 according to Table I; b) analyzing the structural and chemical feature complementarity between the test molecule and all or any part said Site II; and c) screeningthe test molecule in an assay that characterizes binding to a Site II. A test molecule that binds to Site II is identified as a ligand of Site II. The method may further comprise one or more of the following steps: d) screening the test molecule in abiological assay of modulation of an NHR; and e) screening the test molecule in an assay that characterizes binding to Site I.

A preferred ligand of Site II was identified by screening a test molecule in an assay that characterizes binding to Site II.

Preferably said NHR is an SHR, more preferably a GR.

In the present methods of treatment, a modulator of an NHR can induce one or more of the following four activities in the NHR. This list is not meant to be inclusive. (1) A modulator of an NHR can induce transrepression. (2) A modulator of anNHR can induce transactivation. (3) A modulator of an NHR can inhibit or antagonize the ability of another modulator from inducing transrepression. (4) A modulator of an NHR can inhibit or antagonize the ability of another modulator from inducingtransactivation.

Preferably said modulator of an NHR is a modulator of an SHR, more preferably a modulator of GR.

A modulator of an NHR, SHR or GR that induces transrepression includes, but is not limited to, a dissociated compound.

Preferably said modulator of an NHR induces transrepression. More preferably said modulator of an NHR is a dissociated compound. More preferably said modulator of an NHR is an SHR dissociated compound. Most preferably said modulator of an NHRis a GR dissociated compound.

Preferably said subject is a mammal, most preferably a human.

Other therapeutic agent(s), such as those described above in the section on pharmaceutical compositions, may be employed with the modulators in the present methods. In the methods of the present invention, such other therapeutic agent(s) may beadministered prior to, simultaneously with or following the administration of the compound(s) of the present invention.

Modes of administration useful in the present invention are described above in the section of pharmaceutical compositions.

In a particular embodiment, the modulators of the present invention are useful for the treatment of the aforementioned exemplary disorders irrespective of their etiology, for example, for the treatment of transplant rejection, rheumatoidarthritis, inflammatory bowel disease, and viral infections.

Methods of Designing Mutants

We have identified Site II in NHRs as a binding site whose ligands modulate NHRs. Now that Site II is known to be a region of interest, mutants of NHRs, and mutants of portions of NHRs, in which Site II is mutated may be made.

Thus, the invention provides a method of designing a mutant comprising making one or more amino acid mutations in a Site II. The mutant so designed may be an NHR or a portion of an NHR, such as the LBD.

Preferably the mutation(s) is a deletion or substitution of one or more of the amino acids of said Site II. When the mutation(s) is an amino acid insertion, preferably the amino acid(s) inserted are inserted next to an amino acid of said SiteII.

Preferably a mutation involves one or more of the following amino acids in human GR: E537-V543, V571-W577, S599-W600, F602-L603, F606-A607, W610, R614, Q615, P625, Y663, L664 and K667, or one or more of the corresponding amino acids in anotherNHR or non-human GR of SEQ ID NO:13 as can be seen in FIGS. 2 and 6 respectively. Preferably a mutation involves one or more of the following amino acids in human GR: E537-V543, V571-W577, S599-W600, F602-L603, F606-A607, W610, R614, Y663, L664 andK667, or one or more of the corresponding amino acids in another NHR or non-human GR of SEQ ID NO:13 as can be seen in FIGS. 2 and 6 respectively. Preferably the deletion or substitution is of one or more of the aforementioned amino acids orcorresponding amino acids, and preferably the insertion is next to one or more the aforementioned amino acids or corresponding amino acids.

The method may further comprise using all or part of a model of a Site II to visualize all or part of Site II in its mutated or native form. Preferably said model is a three-dimensional model.

Mutation includes one or more amino acid deletions, insertions, inversions, repeats, or substitutions as compared to the native protein. Various methods of making mutations are known to one of ordinary skill in the art. A mutant may have thesame, similar, or altered activity as compared to the native protein. Activity refers to transrepression, transactivation, and ligand binding. Preferred mutants have at least 25% sequence identity, more preferably 50% sequence identity, more preferably75% sequence identity, and most preferably 95% sequence identity to the native protein.

A mutant designed by the method of the invention that has the same or similar biological activity as the native NHR or native portion of NHR may be useful for any purpose for which the native is useful. A mutant designed by the method of theinvention that has altered biological activity as the native may be useful in binding assays to test the ability of a potential ligand to bind to or associate with Site II. A mutant designed by the method of the invention that has the altered biologicalactivity from the native may be useful in further elucidating the biological role of Site II.

Example 16 illustrates designing mutants comprising making one or more amino acid mutations in Site II.

Mutants of Site II

The invention provides a mutant NHR, or a mutant portion of an NHR, comprising one or more amino acid mutations in Site II.

Said mutant portion of an NHR preferably comprises a mutant LBD of the NHR, more preferably consists of a mutant LBD of the NHR.

Preferably the mutation(s) is a deletion or substitution of one or more of the amino acids of Site II. When the mutation(s) is an amino acid insertion, preferably the amino acid(s) inserted are inserted next to an amino acid of Site II.

Preferably a mutation involves one or more of the following amino acids in human GR: E537-V543, V571-W577, S599-W600, F602-L603, F606-A607, W610, R614, Q615, P625, Y663, L664 and K667, or one or more of the corresponding amino acids in anotherNHR or non-human GR of SEQ ID NO:13 as can be seen in FIGS. 2 and 6 respectively. Preferably a mutation involves one or more of the following amino acids in human GR: E537-V543, V571-W577, S599-W600, F602-L603, F606-A607, W610, R614, Y663, L664 andK667, or one or more of the corresponding amino acids in another NHR or non-human GR of SEQ ID NO:13 as can be seen in FIGS. 2 and 6 respectively. Preferably the deletion or substitution is of one or more of the aforementioned amino acids orcorresponding amino acids, and preferably the insertion is next to one or more the aforementioned amino acids or corresponding amino acids.

Mutation includes one or more amino acid deletions, insertions, inversions, repeats, or substitutions as compared to the native protein. Various methods of making mutations are known to one of ordinary skill in the art. A mutant may have thesame, similar, or altered activity as compared to the native protein. Activity refers to transrepression, transactivation, and ligand binding. Preferred mutants have at least 25% sequence identity, more preferably 50% sequence identity, more preferably75% sequence identity, and most preferably 95% sequence identity to the native protein.

A mutant of the present invention that has the same or similar biological activity as the native NHR, or native portion of NHR, may be useful for any purpose for which the native is useful. A mutant of the present invention that has alteredbiological activity as the native may be useful in binding assays to test the ability of a potential ligand to bind to or associate with Site II. A mutant of the present invention that has the altered biological activity from the native may be useful infurther elucidating the biological role of Site II.

In preferred mutants, the mutation consists of five or fewer substitutions, more preferably four or fewer substitutions, more preferably three or fewer substitutions, more preferably two or fewer substitutions, most preferably one substitution. A substitution is preferably a conservative amino acid substitution.

In preferred mutants, the mutation consists of three or fewer deletions, more preferably two or fewer deletions, most preferably one deletion.

In preferred mutants, the mutation consists of two or fewer substitutions and two or fewer deletions.

Example 16 illustrates mutants comprising making one or more amino acid mutations in Site II.

Site II Binding Assay

The invention provides a method of measuring the binding of a test molecule to Site II comprising: (a) incubating an NHR with a ligand of Site II and said test molecule; and (b) measuring the ability of said test molecule to compete for bindingto said Site II with said ligand; wherein said ability to compete is the measure of binding of said test molecule to Site II. The method may further comprise comparing the ability of said test molecule to modulate a native NHR and to modulate an NHRmutated in Site II.

The ligand of Site II may be identified by any art-recognized method, such as those described in Examples 15 and 16.

The NHR may be in a purified form, in a partially purified form, or in a cell lysate.

In order to measure the ability of said test molecule to compete for binding to Site II with said ligand, the ligand can be labeled, such as radiolabeled or fluorescently labeled. Binding can be measured using any art-recognized technique, suchas fluorescence quenching, fluorescence polarization, filter binding, scintillation proximity assay, among others. The ability to compete is determined by comparing the measured value with the labeled compound alone to the measured value in the presenceof the unlabeled test molecule. A decrease in the measured signal indicates binding of the test molecule.

The ability of said test molecule to modulate a native NHR and to modulate an NHR mutated in Site II can be determined by measuring transrepression and transactivation using methods such as described in Examples 3 and 4.

One such Site II binding assay is described in Example 18. Example 18 provides a method of measuring the binding of a test molecule to Site II by: incubating said test molecule with an NHR, a Site I ligand (such as FITC-dexamethasone), and aknown Site II ligand that inhibits the binding of the Site I ligand to Site I. A test molecule that does not inhibit the binding of the Site I ligand to Site I and does bind to Site II will displace the known Site II ligand, thus allowing the Site Iligand to bind to Site I. The binding of the Site I ligand to Site I can be measured. The comparison of the Site I ligand binding to Site I in the presence of the Site II ligand with and without the test molecule provides a measurement of relativebinding of the test molecule to Site II. In order to measure the ability of said Site I ligand to bind to Site I, the Site I ligand can be labeled, such as radiolabeled or fluorescently labeled. Binding can be measured using any art-recognizedtechnique, such as fluorescence quenching, fluorescence polarization, filter binding, scintillation proximity assay, among others.

Models of Site II

We have identified Site II in NHRs as a binding site whose ligands modulate NHRs. We have focused on Site II as a region of interest in NHRs. Now that Site II is known to be a region of interest, models of Site II, such as three-dimensionalmodels, useful in drug design may be made.

Thus, the invention provides a model comprising all or any part of a Site II, wherein said Site II is a structure defined by structure coordinates that describe conserved residue backbone atoms having a root mean square deviation of not more than2.0 .ANG. from the conserved residue backbone atoms described by the structure coordinates of amino acids E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:13 according to Table I.

In a preferred embodiment the model consists of all or any part of Site II.

In another preferred embodiment the model: (a) comprises all or any part of a Site II, wherein said Site II is a structure defined by structure coordinates that describe conserved residue backbone atoms having a root mean square deviation of notmore than 2.0 .ANG. from the conserved residue backbone atoms described by the structure coordinates of amino acids E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:13 according to Table I; and(b) does not comprise structure coordinates that describe conserved residue backbone atoms having a root mean square deviation of not more than 2.0 .ANG. from the conserved residue backbone atoms described by the structure coordinates of one or more ofamino acids M560, L563, N564, L608, F623, M639, Q642, M646, L732, Y735, C736, T739 and E748 of SEQ ID NO:13 according to Table I. Preferably, said data does not comprise structure coordinates that describe conserved residue backbone atoms having a rootmean square deviation of not more than 2.0 .ANG. from the conserved residue backbone atoms described by the structure coordinates of all of amino acids M560, L563, N564, L608, F623, M639, Q642, M646, L732, Y735, C736, T739 and E748 of SEQ ID NO:13according to Table I. Preferably, the root mean square deviation of part (b) is less than 1.5 .ANG., more preferably less that 1.0 .ANG., yet more preferably less than 0.9, 0.8, 0.7, 0.6 0.5, 0.4, 0.3, 0.2, or 0.1 .ANG., most preferably 0.0 .ANG..

A model of a Site II of the present invention may be any type of art-recognized model, including but not limited to: three-dimensional models; and steric/electrostatic field definition models that can be used to study/compute the putativeinteractions ligands might undergo. A three-dimensional model may be produced through use of structure coordinates, such as are ribbon diagrams.

A three-dimensional model of a Site II of the present invention is useful for designing and identifying ligands and modulators of NHRs.

It should be understood that one skilled in the field is able to make various modifications to the compositions and methods described above, applying the ordinary level of skill in the field, without departing from the spirit or scope of theinvention. All such modifications are intended to be included within the invention as defined in the appended claims.

EXAMPLES

The examples below are provided to illustrate the subject invention and are not intended to limit the invention.

Example 1

Compound Synthesis

The fifty-one compounds used in the following examples were synthesized as follows. These compounds and their synthesis are described in the provisional application entitled "Modulators of the Glucocorticoid Receptor and Method," U.S. Application No. 60/396,877, filed on Jul. 18, 2002, and in utility application entitled "Modulators of the Glucocorticoid Receptor and Method," U.S. application Ser. No. 10/621,909, filed concurrently herewith. The contents of U.S. Application No.60/396,877 and QA266NP are incorporated herein by reference in their entirety.

Preparations

The preparations set out below are for the synthesis of reagents that were not obtained from commercial sources and were employed for the preparation of compounds. All chemical structures in the tables and schemes are racemic unless specifiedotherwise.

Preparation 1

4-[1-(4-Fluoro)naphthyl]aminothiazole 1a

##STR00001## Step 1

To a solution of 4'-fluoro-1'-acetonaphthone (28.69 mmol, 5.4 g) in 1,4-dioxane (18.0 mL) at 0.degree. C. was added bromine (35.13 mmol, 5.61 g). After 3 hours at room temperature the reaction mixture was concentrated in vacuo to give 7.66 g(Y: 100%) of the product of step 1.

Step 2

To a solution of the product of step 1 (28.69 mmol, 7.66 g) in ethyl alcohol (20 mL) at room temperature was added thiourea (36.13 mmol, 2.75 g). After 1 hour at room temperature a precipitate formed. To the reaction mixture was added water(100 mL) and the solid was collected by vacuum filtration. The solid was then washed with water (3.times.100 mL) and dichloromethane (3.times.100 mL). The solid was then dried in vacuo to give 5.5 g (Y: 75%) of the title compound 1a. MS (E+) m/z: 245(MH.sup.+).

In a similar manner the following compounds were prepared from the corresponding ketone.

TABLE-US-00001 Preparation Structure 1b ##STR00002## 1q ##STR00003## 1r ##STR00004## 1t ##STR00005## 1w ##STR00006##

Preparation 2

4-[1-(4-Fluoro)naphthyl]aminoimidazole 2a

##STR00007## Step 1

To a solution of the product of preparation 1a, step 1 (18.73 mmol, 5.0 g) in DMF (15 mL) at room temperature was added 1-acetylguanidine (57.43 mmol, 5.80 g). After 5 hours at room temperature, the reaction mixture was diluted with water (100mL) and extracted with ethyl acetate (3.times.100 mL). The organic phases were concentrated in vacuo and the residue chromatographed on silica gel (eluted with 5% methanol in dichloromethane) to give 2.0 g (Y: 39%) of the product of step 1. MS (E+)m/z: 270 (MH.sup.+).

Step 2

To a solution of the product of step 1 (7.43 mmol, 2.0 g) in methanol (17 mL) was added water (8.5 mL) and 12 N HCl (12.0 mL). After 1 hour at reflux the reaction mixture was concentrated in vacuo to approximately 15 mL. The resulting solutionwas then purified and neutralized by cation exchange SPE to give 1.66 g (Y: 99%) of the title compound 2a. MS (E+) m/z: 228 (MH.sup.+).

In a similar manner the following compounds were prepared from the corresponding ketones.

TABLE-US-00002 Preparation Structure 2b ##STR00008## 2e ##STR00009##

Preparation 3

4-(1-naphthyl)aminooxazole 3a

##STR00010## Step 1

To a solution of 1-acetonaphthone (29.38 mmol, 5.0 g) in glacial acetic acid (10.0 mL) at RT was added bromine (30.06 mmol, 4.80 g) in glacial acetic acid (5.0 mL). After 5 minutes the reaction mixture was poured onto crushed ice and extractedwith dichloromethane to give 7.31 g (Y: 100%) of the product of step 1. MS (E+) m/z: 250 (MH.sup.+).

Step 2

To a solution of the product of step 1 (5.50 mmol, 1.37 g) in ethyl alcohol (10 mL) was added urea (27.50 mmol, 1.65 g). After 2 hours at reflux the reaction mixture was concentrated in vacuo and the residue chromatographed on silica gel (elutedwith 30% ethyl acetate in hexane) to give 100 mg (Y: 9%) of the title compound 3a. MS (E+) m/z: 211 (MH.sup.+).

Preparation 6

4-[1-(6-Methoxy)naphthyl]-3-aminothiazole 6a

##STR00011## Step 1

To a solution of 6-methoxy-1-naphthoic acid (0.5 g, 2.47 mmol, 1.0 equi.) in dichloromethane (10 mL) at room temperature was added a solution of oxalyl chloride (2M in dichloromethane, 2.5 mL, 5.0 mmol, 2 equi.). The solution was stirred at roomtemperature for 2 hours, and the excess oxalyl chloride removed in vacuo. The residue was dissolved in methanol and stirred at room temperature for 18 hours. The solvent was removed in vacuo, yielding 0.45 g (84%) of the product of step 1: LC/MS (m/z217, (M-H).sup.+); .sup.1H NMR (CDCl.sub.3) .delta. 8.82 (d, 1H), 8.03 (dd, 1H), 7.90 (d, 1H), 7.44 (t, 1H), 7.26 (dd, 1H), 7.16 (s, 1H), 4.02 (s, 3H), 3.95 (s, 3H).

Step 2

Reference: P. Chen, P. T. Cheng, S. H. Spergel, R. Zahler, X. Wang, J. Thottathil, J. C. Barrish, R. P. Polniaszek, Tetrahedron Letters, 38, 3175 (1997).

To a solution of the product of step 1 (0.238 g, 1.1 mmol, 1.0 equi.) and chloroiodomethane (0.32 mL, 4.4 mmol, 4 equi.) in THF (5 mL) was added a solution of LDA (2M, 2.2 mL, 4.0 equi.) in THF (10 mL) dropwise in 30 minutes, while keeping thesolution temperature at -78.degree. C. The reaction solution was stirred at -78.degree. C. for 10 minutes. A solution of acetic acid (1.5 mL) in THF (10 mL) was added in dropwise in 10 minutes. After stirring for an additional 10 minutes at-78.degree. C., the solution was quenched with ethyl acetate and saturated sodium chloride solution. The organic phase was washed with saturated sodium bisulfite, saturated sodium chloride, dried with sodium sulfate and concentrated in vacuo. Theresidue was purified by flash chromatography (10% ethyl acetate in hexane) to yield the 0.23 g (90%) of the product of step 2: LC/MS (m/z 235, (M+H).sup.+); .sup.1H NMR (CDCl.sub.3) .delta. 8.82 (d, 1H), 8.03 (dd, 1H), 7.90 (d, 1H), 7.44 (t, 1H), 7.26(dd, 1H), 7.16 (s, 1H), 4.80 (s, 2H), 3.95 (s, 3H).

Step 3

To a solution of the product of step 2 (0.23 g, 1.0 mm01, 1.0 equi.) in ethanol (5 mL) at room temperature was added thiourea (90 mg, 1.2 mmol, 1.2 equi.). The reaction solution was stirred at room temperature for 2 hours, after which a yellowprecipitate was formed. The reaction was quenched by addition of water and ethyl acetate. The aqueous phase was extracted with ethyl acetate (3.times.). The combined organic phases were dried with sodium sulfate and concentrated in vacuo to yield 200mg (78%) of the title compound 6a: LC/MS (m/z 235, (M+H).sup.+); .sup.1H NMR (CDCl.sub.3) .delta. 8.1 (d, 1H), 7.9 (m, 1H), 7.43 (m, 2H), 7.25 (m, 1H), 7.10 (dd, 1H), 6.65 (s, 1H), 3.95 (s, 3H).

Preparation 7

4-[1-(6-Methoxy)naphthyl]-3-aminoimidazole 7a

##STR00012## Step 1

To a solution of the product of preparation 6, step 2 (0.5 g, 2.14 mmol, 1.0 equi.), in ethanol (5 mL) at room temperature was added 1-acetylguanidine (650 mg, 6.42 mmol, 3.0 equi.). The reaction solution was stirred at room temperature for 24hours. The reaction was quenched by addition of water and ethyl acetate. The aqueous phase was extracted with ethyl acetate (3.times.). The combined organic phases were dried with sodium sulfate and concentrated in vacuo to yield 0.2 g (35%) of theproduct of step 1: LC/MS (m/z 282, (M+H).sup.+).

Step 2

To a solution of the product of step 1 (0.2 g, 0.7 mmol, 1.0 equi.) in methanol (5 mL) was added water (1.0 mL) and hydrochloric acid (12N, 1.0 mL). The reaction solution was heated to reflux for 1 hour, after which the solvent was removed invacuo. The crude mixture was purified by cation exchange SPE to give 0.12 g (70%) of the title compound 7a: LC/MS (m/z 240, (M+H).sup.+).

Preparation 14

##STR00013## Step 1 Ref: B. Bacle and G. Levesque, Polymer Communications, 28, 36 (1987).

A 1L flask was charged with anthracene (14 g, 0.078 mol, 1.0 equi.), hydroquinone (0.8 g, 0.008 mol, 0.1 equi.), methacrylic acid (14 mL, 0.156 mol, 2.0 equi.) and xylene (500 mL). The solution was heated to reflux for 1 day. The solution wascooled and concentrated in vacuo. The residue was dissolved in ethyl acetate and extracted with 1N NaOH (3.times.). The aqueous phase was acidified with 1N HCl, and the product was extracted with ethyl acetate (3.times.). The combined organic phaseswere concentrated in vacuo to give the crude product mixture. Recrystallization with hexane and ethyl acetate to yield 8 g (40%) of step 1, 14:LC/MS (m/z 263 (M-H).sup.+); .sup.1H NMR (CDCl.sub.3) .delta. 7.08-7.25 (m, 8H), 4.37 (s, 1H), 4.25(t, 1H),2.61 (dd, 1H), 1.39 (dd, 1H), 1.07 (s, 3H).

Step 2

The product of step 1, 14 was resolved into its corresponding enantiomers, 14(R) and 14(S) by chiral preparative HPLC with the following conditions, Column: Chiracel.RTM.-OJ, 5.times.50 cm, Mobile phase: trifluroacetic acid/acetonitrile: 1/1000(vol/vol), Temperature: ambient, Flowrate: 70 mL/min, Injection: 1.5 grams in 50 mL solvent, Detection: UV (250 nm). Retention times for R-enantiomer, 30 min, S-enantiomer, 52 min. Analytical HPLC conditions, Column: Chiracel.RTM.-OJ, 4.6.times.250 cm,Mobile phase: trifluroacetic acid/acetonitrile: 1/1000 (vol/vol), Temperature: ambient, Flowrate: 1.5 mL/min, Detection: UV (250 nm). Retention times: R-enantiomer, 6.5 min, S-enantiomer, 15 min.

In a similar manner the following compounds were prepared from the corresponding 9-nitroanthracene and 9-anthracenecarbonitrile (Reference: P. V. Alston, R. M. Ottenbrite, J. Newby, J. Org. Chem. J. Org. Chem. 44, 4939 (1979)) and were resolvedto the enantiomers according to the procedure of Step 2.

TABLE-US-00003 Preparation 14 Structure 14b ##STR00014## 14c ##STR00015##

EXAMPLES

Example 1

Compound 1

##STR00016##

To a solution of the product of Preparation 14, step 1 (20 mg, 0.075 mmol, 1.0 equi.) in acetonitrile (2 mL) was added 1-[3-(dimethylamino)propyl]-3-ethylcarbodiimide hydrochloride (DEC) (17 mg, 0.09 mmol, 1.2 equi.), 1-hydroxy-7-azabenzotriazole(HOAt) (12 mg. 0.09 mmol, 1.2 equi.), triethyl amine (0.025 mL, 0.18 mmol, 2.5 equi.), and 2-amino-4,5-dimethylthiazole hydrochloride salt (14.8 mg, 0.09 mmol, 1.2 equi.). The reaction solution was heated to 80.degree. C. for 18 hours. The reactionwas then concentrated in vacuo. The product mixture was purified by flash chromatography (20% ethyl acetate in hexane) to yield 19.8 mg (70%) of Example 1. LC/MS (m/z 375, (M+H)+.

In a similar manner Examples 2-51 were prepared from the coupling of the appropriate acids (14, 14R, 14S, 14a, 14aR, 14aS, 14b, 14bR, 14bS)) prepared as described in Preparation 14 and the appropriate amines. Preparations of amines notcommercially available are described in the preceding preparations section of this document. All examples in the tables are racemic unless specified otherwise. Examples in the table where one enantiomer predominates or is the sole component, aredesignated as either R or S.

TABLE-US-00004 Example Compound Chiral MS: (M + H = MW Number Number Compounds Structure shown +1) 2 2 ##STR00017## 3 3 Chiral (R) ##STR00018## 4 4 Chiral (S) ##STR00019## 5 5 ##STR00020## 6 6 ##STR00021## 360.5 7 7 ##STR00022## 360.5 8 8##STR00023## 379.47 9 9 ##STR00024## 329.41 10 10 ##STR00025## 422.6 11 11 ##STR00026## 457 12 12 ##STR00027## 402.6 13 13 ##STR00028## 458.5 14 14 ##STR00029## 436.6 15 15 ##STR00030## 472.6 16 16 ##STR00031## 450.6 17 17 Chiral (R) ##STR00032## 472.6118 18 Chiral (S) ##STR00033## 472.61 19 19 ##STR00034## 472.6 20 20 ##STR00035## 422.55 21 21 ##STR00036## 456.55 22 22 ##STR00037## 478.64 23 23 ##STR00038## 386.5 24 24 ##STR00039## 432.57 25 25 ##STR00040## 391.5 26 26 ##STR00041## 423.5 27 27##STR00042## 390.5 28 28 ##STR00043## 486.64 29 29 ##STR00044## 455.56 30 30 ##STR00045## 452.58 31 31 ##STR00046## 502.64 32 32 Chiral (R) ##STR00047## 486.64 33 33 Chiral (S) ##STR00048## 486.64 34 34 Chiral (R) ##STR00049## 490.6 35 35 Chiral (S)##STR00050## 490.6 36 36 Chiral (S) ##STR00051## 502.64 37 37 Chiral (R) ##STR00052## 502.64 38 38 Chiral (S) ##STR00053## 455.56 39 39 Chiral (R) ##STR00054## 455.56 40 40 Chiral (S) ##STR00055## 469.59 41 41 Chiral (R) ##STR00056## 469.59 42 42 Chiral(S) ##STR00057## 485.59 43 43 Chiral (R) ##STR00058## 485.59 44 44 Chiral (S) ##STR00059## 473.55 45 45 Chiral (R) ##STR00060## 473.55 46 46 Chiral (R) ##STR00061## 551.51 47 47 Chiral (S) ##STR00062## 551.51 48 48 Chiral (R) ##STR00063## 532.29 49 49Chiral (S) ##STR00064## 532.29 50 50 Chiral (R) ##STR00065## 512.27 51 51 Chiral (S) ##STR00066## 512.24

Example 2

Site I Binding Assay

In order to measure the binding of compounds to Site I on the glucocorticoid receptor a commercially available kit was used (Glucocorticoid receptor competitor assay kit, Panvera Co., Madison, Wis.). Briefly, a cell lysate containingrecombinantly expressed human full-length glucocorticoid receptor was mixed with a fluorescently labeled glucocorticoid (4 nM FITC-dexamethasone) plus or minus test molecule. After one hour at room temperature, the fluorescence polarization (FP) of thesamples were measured. The FP of a mixture of receptor, fluorescent probe (i.e. FITC-dexamethasone) and 1 mM dexamethasone represented background fluorescence or 100% inhibition, whereas, the FP of the mixture without dexamethasone was taken to be 100%binding. The percentage inhibition of test molecules were then compared to the sample with 1 mM dexamethasone and expressed as % relative binding activity with dexamethasone being 100% and no inhibition is 0%. Test molecules were analyzed in theconcentration range from 0.1 nM to 40 .mu.M.

Site I binding assays for any NHR are conducted similarly to the above. An appropriate cell lysate or purified NHR is used as the source of the NHR. The fluorescent probe and unlabeled competitor are appropriate for the specific NHR, i.e. areligands for the specific NHR.

Example 3

Cellular Transrepressional Assay

To measure the ability of test molecules to inhibit AP-1 induced transcriptional activity we utilized an A549 cell which was stably transfected with a plasmid containing 7.times.AP-1 DNA binding sites (pAP-1-Luc plasmid, Stratagene Co. La Jolla,Calif.) followed by the gene for luciferase. Cells were activated with 10 ng/ml of phorbol myristic acid (PMA) plus or minus test molecules for 7 hours. After 7 hours a luciferase reagent was added to measure luciferase enzymatic activity in the cell. After a 10 minute incubation of luciferase reagent with cells, luminescence was measured in a TopCount luminescence counter. Repression of AP-1 activity was calculated as the percentage decrease in the signal induced by PMA alone. Test molecules wereanalyzed in the concentration range from 0.1 nM to 40 .mu.M. IC50s were determined by using standard curve fitting methods such as Excel fit (Microsoft Co.). An IC50 is the test molecule concentration which causes a 50% repression of transcription,i.e. a 50% reduction of AP-1 activity.

Other reporters and cell lines also may be used in a cellular transrepressional assay. A similar assay is performed in which NF-.kappa.B activity is measured. A plasmid containing NF-.kappa.B DNA binding sites is used, such as pNF-kB-Luc,(Stratagene, LaJolla Calif.), and PMA or another stimulus, such as TNF-.alpha. or lipopolysaccharide, is used to activate the NF-.kappa.B pathway. NF-.kappa.B assays similar to that described in Yamamoto K., et al., J Biol Chem 1995 Dec. 29;270(52):31315-20 may be used.

The cellular transrepressional assays described above may be used to measure transrepression by any NHR. One of skill in the art will understand that assays may require the addition of components, such as a stimulus (eg. PMA,lipopolysaccharide, TNF-.alpha., etc) which will induce transcription mediated by AP-1 or NF-.kappa.B. Additionally, AR mediated transrepression may be measured by the assay described in Palvimo J J, et al. J Biol Chem 1996 Sep. 27;271(39):24151-6, andPR mediated transrepression may be measured by the assay described in Kalkhoven E., et al. J Biol Chem 1996 Mar. 15;271(11):6217-24.

Example 4

Cellular Transcriptional Assay

In order to measure the ability of compounds to induce DNA binding and transcriptional activation in cells the following assay was performed. A HeLa cell line was stably transfected with a gene expressing a fusion protein consisting of the GAL4DNA binding domain linked to the ligand binding domain of GR. Also transfected into these cells was a DNA binding site for GAL4 (5 repetitions of a 17-mer GAL4 binding site) linked to the beta-globin reporter in front of the luciferase gene. SeeEisenmann, G., Cheynel, and Gronemeyer, H. (1995), Quand les cellules scintillent, Biofutur (Le Technoscope), 151: 8. Cells were incubated for 20 hours with either dexamethasone or test molecule. After 20 hours the level of luciferase activity wasmeasured using a Steady Glo Luciferase assay system (Promega Co., Madison, Wis.). Induction of luciferase activity with 100 nM dexamethasone was considered 100% activation. The activity of test molecules was measured as a percentage of dexamethasoneinduced DNA binding (transactivation). EC50s were calculated by using standard curve fitting methods such as Excel Fit (Microsoft Co., Redmond, Wash.). An EC50 is the test molecule concentration required to cause a 50% stimulation of transcription.

A second assay which measures the ability of compounds to induce the expression of tyrosine amino transferase mRNA in liver cells was also utilized to determine the ability of compounds to induce DNA binding. In these experiments, an HTC cellline was treated with dexamethasone or test molecules for 20 hours followed by mRNA extraction and analysis by RT-PCR. Again, dexamethasone induction (100 nM) was considered 100% activation. Test molecules were analyzed in the concentration range from0.1 nM to 40 .mu.M.

Cellular transcription transactivated by any NHR may be measured using an assay similar to the one described above for GR. That is, the NHR (either full length or the ligand binding domain) of interest is overexpressed in a suitable cell linesuch as COS. A plasmid which contains the DNA binding element specific for the NHR attached to a promoter and linked upstream of a reporter gene (e.g. luciferase), is co-transfected with the NHR. A chimeric NHR-- ligand binding domain fused to GAL4, orother transcription factor, could also be used to measure transactivation mediated by ligand binding to the NHR. In this case, the DNA binding element would be specific for the NHR fusion partner. An appropriate nuclear hormone is used for comparisonto the test molecule. The cell line is treated with test molecule and reporter gene activity measured.

Example 5

GR Binding Activity AP-1 Inhibitory Activity, and Transactivational Activity of Racemic Mixtures

Each of the twenty-seven racemic mixtures described in Example 1 was tested in the GR Site I binding assay, the cellular transrepressional assay, and the cellular transcriptional assay. The results are given in Table II below, in Example 10. GRSite I binding of the compounds ranged from 20.0-99.1% inhibition at 10 .mu.M concentration. AP-1 inhibition in the cellular transrepressional assay ranged from 0.8-82.9% at 10 .mu.M concentration. EC50s for DNA binding in the cellular transcriptionalwere determined for some of the compounds and were greater than 40 .mu.M for all but one.

The EC50 for dexamethasone induction of tyrosine amino transferase mRNA in the HTC cell line is approximately 50 nM. Two racemic mixtures of Example 1 were analyzed in the tyrosine amino transferase mRNA assay and had EC50s of greater than 40.mu.M.

Example 6

Enantiomeric Separation of Twelve Racemates

Twelve compounds which were originally synthesized as racemic mixtures were separated into enantiomeric pairs, and the enantiomeric identity of each member of the pair was determined using standard techniques known in the art. These twenty-fourenantiomers are among the compounds of Example 1.

Example 7

GR Binding Activity AP-1 Inhibitory Activity, and Transactivational Activity of Twenty-four Enantiomers

Each of the twenty-four enantiomers was tested in the cellular transcriptional assay. All but one of the twenty-four enantiomers were tested in the cellular transrepressional assay. Most of the twenty-four enantiomers were tested in the GR SiteI binding assay. Two enantiomers (one pair) were tested in the tyrosine amino transferase mRNA assay.

EC50s for DNA binding in the cellular transcriptional assay were greater than 40 .mu.M for all but three of the twelve S enantiomers and for all but two of the twelve R enantiomers. For ten of the S enantiomers, EC50s for DNA binding in thecellular transcriptional assay were greater than 40 .mu.M for all but one. For ten of the R enantiomers, EC50s for DNA binding in the cellular transcriptional assay were greater than 40 .mu.M for all. IC50s for AP-1 inhibition in the cellulartransrepressional assay ranged from 15 nM to 11 .mu.M for the twelve S enantiomers, with the range for eleven of the S enantiomers being 15 nM to 275 nM. IC50s for AP-1 inhibition in the cellular transrepressional assay ranged from 33 nM to 11 .mu.M forten of the S enantiomers, with the range for nine of those S enatiomers being 33 nM to 275 nM. IC50s for AP-1 inhibition in the cellular transrepressional assay ranged from 222 nM to 40 .mu.M for the twelve R enantiomers, with the range for ten of the Renantiomers being 650 nM to 40 .mu.M. GR Site I binding inhibition at 10 .mu.M ranged from 6.1% to 41% for the S enantiomers, and from 51.8% to 99% for the R enantiomers, with the range being 51.8% to 97.9% for ten of the R enantiomers. Bothenantiomers of the pair tested had EC50s of greater than 40 .mu.M in the tyrosine amino transferase mRNA assay.

This data clearly shows that the S enantiomers were more potent inhibitors of AP-1 activity relative to the R enantiomers. In contrast, the R enantiomers were more potent inhibitors of dexamethsone binding to GR compared to the S enantiomers.

Example 8

Dissociation of Twenty-four Enantiomers Compounds

The dissociation of the twenty-four enantiomers was calculated by dividing the EC50 from the cellular transcriptional assay by the IC50 from the cellular transrepressional assay. The dissociation constant for the R enantiomers ranged from 62.5to 1.0. The dissociation value for the S enantiomers ranged from 1000 to 0.91, with the dissociation value for eleven of the S enantiomers ranging from 1000 to 137, and the dissociation value for some of the S enantiomers ranging from 1000 to 167.

Example 9

GR Homology Model

The GR homology model of the ligand binding domain (LBD) was constructed using known methodology. Specifically, the human sequence (QRHUGA obtained from the International Protein Sequence Database, pir.georgetown. edulpirwww), residues 523-777(SEQ ID NO:1), comprising the LBD was aligned to the human PR sequence (LBD residues 682-932) (SEQ ID NO:2) available as a xray-structure (1A28.pdb obtained from the RCSB, the Research Collaboratory for Structural Bioinformatics using the modeler modulewithin InsightII (Version 2000, MSI/Accelrys).

TABLE-US-00005 GR: 523 ATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVI 572 (SEQ ID NO:1) 1A28: 682 QLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLL 727 (SEQ ID NO:2) GR: 573 AAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLC 622 1A28: 728SVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLY 777 GR: 623 FAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLL 672 1A28: 778 FAPDLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLL 827 GR: 673 SSVPKDGLKSQELFDEIRMTYIKELGKAIVKRE-GN-SSQNWQRFYQLTK 720 1A28:828 NTIPLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSS--QRFYQLTK 875 GR: 721 LLDSMHEVVENLLNYCFQTFLDKTM-SIEFPEMLAEIITNQIPKYSNGNI 769 1A28: 876 LLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMV 925 GR: 770 KKLLFHQK (SEQ ID NO:1) 777 1A28: 926 KPLLFH-K (SEQ ID NO:2)932

The resulting GR LBD homology model coordinates are provided in Table I, which for convenience is located at the end of this specification under the heading Example 21.

Example 10

Identification of Site II

The classical ligand binding site, i.e. Site I, is defined by the immediate space surrounding progesterone in 1A28.pdb, can be further defined by the amino acid residues in contact with progesterone, and are well known in the art. The analogousGR site I residues were identified as those proximate to a modeled version of dexamethasone in the GR homology model. GR Site I residues in contact with dexamethasone (as found in the GR homology model) are M560, L563, N564, L566, G567, Q570, M601,M604, A605, L608, R611, F623, M639, Q642, M646, L732, Y735, C736, T739 and E748. The present invention is based on the discovery of an alternate binding site, herein known as Site II, present in a number of NHRs (nuclear hormone receptors), inparticular in GR, which interacts with small molecule modulators. In the case of GR, a ligand binding to Site II results in a transrepression signaling within cells (inhibition of AP-1 or NF-.kappa.B). The location of Site II is defined herein for anumber of related NHRs and specifically for GR in FIG. 2. GR Site II residues include the following (using GR numbering): E537-V543, L566, G567, Q570-W577, S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:13.

The identification of Site II is supported by the three-dimensional complementarity of shape and functional features between the site and ligands having in vivo transrepression activity. An example of such complementarity is shown in FIG. 3,wherein the S-enantiomer of Compound 15 was manually docked into the GR homology model of Site II.

Site I and Site II residues were defined as those capable of van der Waal's contact with a ligand contained by those residues. Using dexamethasone for Site I (bound in a similar manner as that reported for progesterone in PR Site I) and Compound15 for Site II (manually docked as shown in FIG. 3), all residues capable of vander Waal's contact were listed as site residues. Included as well were those residues not in immediate contact with either ligand, but capable of such contact if the spacebetween ligand and residue was occupied by a small molecule fragment.

In addition, computations of binding energetics for a series of twenty-seven related Site II ligands, which are among the compounds described in Example 1, was found to correlate with the observed in vivo transrepression activities, providingfurther evidence of the critical role of Site II binding in producing an in vivo transrepression effect. Correlation data are shown in Table II (below) and FIG. 5, and structures are shown in FIG. 4. Although the data reflect the activities ofracemates, each individual molecule was modeled as the S-enantiomer for purposes of consistency. These twenty-seven compounds showed % inhibition at 10 .mu.M in the cellular tranrepressional assay ranging from 0.8 to 82.9. The EC50 in the cellulartranscriptional assay was greater than 40 .mu.M for twenty-six of the compounds, and was greater than 10 .mu.M for the remaining compound.

Binding energetics were calculated using Flo (Colin McMartin, Thistlesoft, High Meadow, 603 Colebrook Road, Colebrook, Conn. 06021), molecular modeling software which utilizes the Amber molecular mechanics force field to achieve a best fitbetween ligand and protein binding site. Both the ligand and Site II residues in contact with the ligand are allowed to undergo energy minimization and geometry optimization. The result of these operations provides an optimum ligand binding orientationand a series of calculated energies of interaction. The correlation between observed AP-1 inhibition (percent at 10 uM) and binding energetics is based on the calculated non-bonded contact interactions between ligand and protein residues. This type ofcalculation generally reflects the degree to which a ligand conforms to the shape of the binding site.

Table II, below, gives correlation data calculated for the analogues of Compound 15 using Flo Contact Energy Scores (Ecnt) after manually docking each analogue into GR Site II (Flo modeling software, Colin McMartin, ThistleSoft). % AP-1 valueswere determined at an inhibitor concentration of 10 .mu.M. GR binding assay was performed as described in Example 2. DNA binding assay was performed as described in Example 4. AP-1 inhibition assay was performed as described in Example 3.

TABLE-US-00006 TABLE II Correlation Data for Analogues of Compound 15 DNA Binding GR Binding NP-1 IC50 AP-1 Ecnt Compound (% @ 10 uM) (uM) (% inh @ 10 uM) (KJ/mol) 92.1 30.3 -18.7 99.1 24.5 -15.6 97.6 0.8 -17 85.1 >10 29.5 -16.9 92.8 >408.7 -15.1 96.0 36.1 -22.5 91.0 15.2 -19.2 84.9 >40 58.6 -19.4 92.3 25.1 -13.3 93.2 41.3 -22.9 88.1 >40 61.8 -28.9 88.3 22.5 -20.2 92.2 29.3 -15.2 93.5 33.6 -18.4 65.7 61.8 -26.3 93.8 26.4 -27.6 94.1 23.4 -16.3 94.4 47 -18.9 76.8 7 -21.9 20.0 13.6-27.8 64.5 32.7 -18.9 45.3 8.6 -23.3 31.9 18.9 -21.5 90.4 >40 82.9 -29.6 56.3 >40 64.2 -21.2 88.7 38.5 -23.7 91.7 43.8 -25

There are a number of published examples wherein the energetics of interaction of docked structures correlated with observed activity; one such example was in the use of AutoDock (Sybyl, Tripos, St. Louis, Mo.) in evaluating 27 HIV-1 Proteaseinhibitors (Huang, et. al., J. Med. Chem. 45, 333, 2002). Energies of interaction between the HIV-1 protease active site and a series of ligands were calculated using an MM2X force field and found to correlate with observed activities (Holloway and Waiin Computer-Aided Molecular Design, ACS Symposium Series 589, ACS, Washington, D.C. 1995). The solvation contribution to the binding energetics of docked structures was accounted for and provided the means to more accurately predict biologicalactivities (Takamatsu and Itai, Proteins: Structure, Function, and Genetics, 33:62-73, 1998).

Correlating structure with activity is a fundamental criterion in pointing out those aspects of the structure most relevant to activity. When the correlation is carried out with ligands alone, it can demonstrate which properties/features of theligands are important for activity. When done with a protein binding site acting as a constraint, the correlation provides evidence that certain three-dimensional binding site features are important. Thus, when a correlation exists between AP-1inhibition data and the calculated binding energetics for a series of molecules, this provides a reasonable certainty that the binding site model is consistent with the observed inhibition data. Therefore, the design of molecules having featurescomplementary to those of the binding site should lead to the effective structure-based design of novel ligands having desired biological activity, in this case, AP-1 inhibition.

A recent publication (Bledsoe, et. al., Cell, online publication by Cell Press, Jul. 1, 2002; DOI: 10.1016/S0092867402008176) describes the successful crystallization and xray structural elucidation of the glucocorticoid receptor LBD as thedimer. Disruption of the dimeric structure was found to occur upon mutation of selected residues at the dimerization interface. These mutants lacked transactivation activity and retained transrepression activity. Interestingly, the dimerizationinterface and the opening of Site II share the same outer surface (two residues located at the rim of Site II, namely, Q615 and P625, are among several identified by the authors as critical to dimer formation). This observation is consistent with theproposed importance of Site II in modulating dissociated steroid activity.

Example 11

Cellular Transrepressional Assay with Both A Site II Dissociated Compound and Dexamethasone

The cellular transrepressional assay was performed by determining the IC50 for transrepression for dexamethasone in the presence or absence of one of the compounds (an S enantiomer) of Example 1. This S enantiomer is hereinafter referred to asCompound A. In the absence of Compound A dexamethasone yielded an IC50 of 3.4 nM with a maximum percent inhibition of 75%, whereas, in the presence of 800 nM of the compound the IC50 decreased to 1.2 nM with 100% inhibition. This showed that there is anadditive effect of adding the compound with dexamethasone.

Example 12

Cellular Transcriptional Assay with Both A Site II Dissociated Compound and Dexamethasone

For transactivation, the compound used in Example 11, Compound A, was an antagonist of dexamethasone activity. Here, an EC50 was determined in the cellular transcriptional assay for dexamethasone in the presence or absence of the compound. Inthe absence, the EC50 was 3.4 nM with 100% stimulation, whereas, in the presence of the compound the EC50 shifted to 8.5 nM with 47% stimulation.

Example 13

Overlay of Site II from Various NHRs and Calculation of rms

Consensus alignments were carried out using ICM (Molsoft LLC, La Jolla, Calif.) between human GR LBD and other human NHR LBDs. FIG. 2 shows the alignment, indicating by shading the residues of Site II in each NHR, i.e. residues corresponding toresidues of GR Site II. Dots are spaceholders and do not represent amino acids. Numbers refer to the first residue in each line, are specific for each NHR and are based on the full-length NHR. For the NHRs listed below, with the exception of GR andMR, structural data was obtained from the RCSB references listed below, and the numbering system in the RCSB references was used. For GR and MR, structural data was obtained by homology modeling using the literature references below, and the numberingsystem in those literature references was used. The RCSB references (in parentheses) and literature references for the various NHRs are as follows:

RXRalpha (1lbd) Bourguet, W., Ruff, M., Chambon, P., Gronemeyer, H., Moras, D. Nature 375 pp. 377 (1995); PPAR-gamma (2prg) Nolte, R. T., Wisely, G. B., Westin, S., Cobb, J. E., Lambert, M. H., Kurokawa, R., Rosenfeld, M. G., Willson, T. M.,Glass, C. K., Milburn, M. V. Nature 395 pp. 137 (1998); RARgamma (2lbd) Renaud, J. P., Rochel, N., Ruff, M., Vivat, V., Chambon, P., Gronemeyer, H., Moras, D. Nature 378 pp. 681 (1995); PR (1a28) Williams, S. P., Sigler, P. B. Nature 393 pp. 392(1998); VitDR (1db1) Rochel, N., Wurtz, J. M., Mitschler, A., Klaholz, B., Moras, D. Mol. Cell 5 pp. 173 (2000); AR (1e3g) Matias, P. M., Donner, P., Coelho, R., Thomaz, M., Peixoto, C., Macedo, S., Otto, N., Joschko, S., Scholz, P., Wegg, A., Basler,S., Schafer, M., Egner, U., Carrondo, M. A. J. Biol. Chem. 275 pp. 26164 (2000); ERalpha (1a52) Tanenbaum, D. M., Wang, Y., Williams, S. P., Sigler, P. B. Proc Natl Acad Sci USA 95 pp. 5998 (1998); ERbeta (1l2j) Shiau, A. K., Barstad, D., Radek, J.T., Meyers, M. J., Nettles, K. W., Katzenellenbogen, B. S., Katzenellenbogen, J. A., Agard, D. A., Greene, G. L. Nat. Struct. Biol. 9 pp. 359 (2002); TRbeta (1bsx) Wagner, R. L., Darimont, B. D., Apriletti, J. W., Stallcup, M. R., Kushner, P. J.,Baxter, J. D., Fletterick, R. J., Yamamoto, K. R. Genes Dev. 12 pp. 3343 (1998). MR and GR structural data were obtained by homology modeling to PR using the sequences from the following references: GR, PIR Accession Number QRHUGA, Hollenberg, S. M.,Weinberger, C., Ong, E. S., Cerelli, G., Oro, A., Leba, R., Thompson, E. B., Rosenfeld, M. G., Evans, R. M., Nature (1985) 318: 635-641; MR, PIR Accession Number A29613, Arriza, J. L.; Weinberger, C., Cerelli, G., Glaser, T. M., Handelin, B. L., Housman,D. E., Evans, R. M., Science (1987) 237: 268-275.

It is understood that FIG. 2 is merely illustrative of the invention and is not intended to be limiting in any manner. Accordingly, it is understood that corresponding amino acid residues of other nuclear receptors such as other estrogenreceptors, thyroid receptors, retinoid receptors, glucocorticoid receptors, progestin receptors, mineralocorticoid receptors, androgen receptors, peroxisome receptors and vitamin D receptors may also be used in the methods of the invention.

The structure coordinates of Site II in the NHRs of FIG. 2 are given in Table III, located under the heading for Example 22.

Using structural data described above for several NHR LBDs, rigid fitting operations were conducted between the GR LBD homology model and the following closely-related NHRs: progesterone receptor LBD, androgen receptor LBD, estrogen receptoralpha LBD and estrogen receptor beta LBD. The fitting operation yielded Site II rms deviations in backbone atom comparisons of 0.57-0.71 .ANG.. The fitting operations were carried out using the Match option within InsightII. Backbone atoms of GR SiteII were compared to those of the following four NHRs: progesterone receptor (rms=0.57 .ANG.), androgen receptor (rms=0.71 .ANG.), estrogen receptor alpha (rms=0.69 .ANG.), and estrogen receptor beta (rms=0.52 .ANG.).

Example 14

Sequence Alignment of GR Site II from Various Species

Sequence alignments were prepared of the human GR and the GR from various non-human species. The sequence alignments were conducted using the program LOOK (Version 3.5.2 Molecular Applications Group, Palo Alto, Calif.). The alignment is shownin FIG. 6. The sequence for each GR starts at residue 1. Alignments were made based on pair-wise sequence identity. Site II residues are shaded. GR sequences were obtained from the following sources: Squirrel (Saimiri boliviensis boliviensis)(GenBank U87951) Reynolds, P. D., Pittler, S. J. and Scammell, J. G. J. Clin. Endocrinol. Metab. 82 (2), 465-472 (1997); Pig GR (GenBank AF141371) Gutscher, M., Eder, S., Mueller, M. and Claus, R. Submitted to GenBank (08-Apr.-1999) Institut fuerTierhaltung und Tierzuechtung (470), FG Tierhaltung und Leistungsphysiologie, Universitaet Hohenheim, Garbenstr. 17, Stuttgart 70599, Germany; Guinea Pig (GenBank L13196) Keightley, M. C. and Fuller, P. J. Mol. Endocrinol. 8 (4), 431-439 (1994);Marmoset (GenBank U87953) Reynolds, P. D., Pittler, S. J. and Scammell, J. G. J. Clin. Endocrinol. Metab. 82 (2), 465-472 (1997); Ma'z Monkey (GenBank U87952) Reynolds, P. D., Pittler, S. J. and Scammell, J. G. J. Clin. Endocrinol. Metab. 82 (2),465-472 (1997); rat (GenBank M14053) Miesfeld, R., Rusconi, S., Godowski, P. J., Maler, B. A., Okret, S., Wikstrom, A. C., Gustafsson, J. A. and Yamamoto, K. R. Cell 46 (3), 389-399 (1986); mouse (GenBank X04435) Danielsen, M., Northrop, J. P. andRingold, G. M. EMBO J. 5 (10), 2513-2522 (1986); Human (Protein Information Resource QRHUGA) Hollenberg, S. M., Weinberger, C., Ong, E. S., Cerelli, G., Oro, A., Leba, R., Thompson, E. B., Rosenfeld, M. G., Evans, R. M., Nature (1985) 318: 635-641.

Example 15

Site II Binding Assay

In order to measure binding of a test molecule (i.e. a potential ligand) to Site II on GR, a labeled, such as radiolabeled or fluorescently labeled, known ligand of Site II is prepared. Several approaches can be utilized to identify a ligand ofSite II that can be used as the labeled known ligand of Site II. All involve analyzing a modulator of GR to determine if it is a ligand of Site II. Three such approaches follow.

The first approach involves making mutations in GR in site II. These Site II mutants are expressed in the transactivation and/or transrepression assays to determine if there is any alteration of the modulator's activity. It would be predictedthat those amino acids which are in proximity to the compound, if mutated, should decrease the activity of the modulator in the transrepression assay, whereas, there should be no effect on the activity of dexamethsone mediated tranactivation and/ortransrepression. This approach is used in Example 16.

A second approach is to prepare a modulator with a moiety that can be crosslinked to GR, such as dexamethasone mesylate. After crosslinking, the GR is digested with proteases and analyzed by mass spectrometry. The peptide(s) with a covalentlyattached modulator are identified.

A third approach is to crystallize the GR with the modulator. The structure of the co-crystal complex definitively shows the mode in which the modulator is binding to GR.

Once a ligand is identified, it is labeled and is used in the assay to measure binding of a test molecule to Site II. The test molecule and the labeled ligand are incubated with a cell lysate or purified complex containing GR. The binding ofcompounds to GR are measured using techniques which are standard in the art such as fluorescence quenching, fluorescence polarization, filter binding, scintillation proximity assay, among others. The readout, such as fluorescence polarization, of amixture of receptor, labeled ligand and 1 mM unlabeled ligand represents 100% competition, whereas, the readout of the mixture without unlabeled ligand is taken to be 100% binding. The percentage competition of test molecules are then compared to thesample with 1 mM unlabeled ligand and expressed as % relative binding activity with unlabeled ligand being 100% and no competition being 0%. Test molecules are analyzed in the concentration range from 0.1 nM to 40 .mu.M.

To confirm binding of a test molecule to Site II, a GR that has mutations in Site II may be used. It would be expected that a GR with mutations in Site II would have a diminished ability to be modulated by a ligand of Site II. Modulation by thetest molecule, i.e. transrepression and transactivation, is compared between the native GR and the mutant GR.

Site II binding may also be confirmed by demonstrating that a steroid known to bind to Site I, such as dexamethasone, does not compete for the binding of the test molecule to Site II.

To determine an IC50, a fixed concentration of labeled ligand is used and a titration with unlabeled test molecule is performed. Test molecules are analyzed in the concentration range from 0.1 nM to 40 .mu.M.

A Site II binding assay may be prepared using any NHR in place of GR as described above. Cross-linking agents and ligands appropriate for the specific NHR are used.

Example 16

Transactivation Studies on GR Site-Directed Mutants

Several mutations in Site II of the human glucocorticoid receptor were made. Two mutations of Alanine 607 to either a valine or phenylalanine were made which were predicted to block the entrance of Site II ligands into the Site II pocket. Valine 543, which is on the interior of the Site II pocket, was mutated to phenylalanine, and this mutation was predicted to disrupt binding of compounds to Site II. A double mutant A607V/V543L was also made. These mutations were made using acommercially available kit, Stratagene Quick Change XL Site Directed Mutagenesis Kit (Stratagene, La Jolla, Calif.).

COS cells were transfected with expression vectors for either the wild type or the various mutants. Cells were also transfected with a highly sensitive, artificial reporter consisting of two glucocorticoid response elements upstream of the genefor luciferase, the GRE2LUC reporter. (PROMEGA steady glo luciferase assay system, Promega, Madison, Wis.). After 24 hours the cells were then treated for an additional 24 hours with either dexamethasone (Dex), or Site II ligands. At the end of theincubation period, luciferase levels were measured using the PROMEGA steady glo luciferase assay system (Promega, Madison, Wis.).

The data is shown in FIG. 8, in which RLU means relative light units. FIG. 8 shows that in the wild type GR, both dexamethasone and Compound A can induce transactivation via the GRE2LUC reporter. However, in the A607F, A607V and V543F mutants,whereas dexamethsone induced transactivation of the reporter, Compound A did not. Compound A is indicated by the left, darker, solid bar in each pair of bars. Dexamethasone is indicated by the right, lighter, hatched bar in each pair of bars. Thecontrol is cells transfected with DNA vector alone (no GR) plus the GRE2LUC reporter. These data suggest that either Compound A interacts with amino acids V543 and A607 in Site II or the mutations prevent the interaction of Compound A with GR.

Glucocorticoid receptor transactivation activity is very sensitive to mutations which may alter the conformation of the receptor. As seen in FIG. 8, some point mutations enhance the ability of dexamethasone to induce transactivation. This mayoccur due to, among other explanations, an increase in the ability of dexamethasone to bind to GR or increased ability to recruit co-activators. The double mutant caused a decrease in the ability of dexamethasone to induce transactivation perhaps due toa more dramatic effect on the conformation of GR and a decreased ability to bind to dexamethasone or recruit co-activators.

Example 17

Effect of Combining BMS Site II Compounds with Dexamethasone or RU486 on AP-1 Mediated Transcription

A549 cells stably transfected with an AP-1 reporter with a luciferase readout, as described in Example 3, were treated with various concentrations of compounds. As shown in FIG. 9, a titration of dexamethasone was performed in the presence orabsence of Compound A (an S enantiomer) or Compound B (the R enantiomer of Compound A). As seen in FIG. 9, these compounds increase the percentage of inhibition of AP-1 relative to dexamethasone alone, suggesting there is an additive effect betweenthese Site II compounds and dexamethasone. In contrast, RU486 (Hoffmann T G, Hehner S P, Bacher S, Droge W, Schmitz M L. FEBS Lett. 1998 Dec. 28;441(3):441-6), which is an antagonist of Site I, which is the dexamethasone binding site, inhibits theability of dexamethasone to repress AP-1 activity. The data taken together demonstrates that Compound A and Compound B act in an additive fashion with compounds which interact with Site I, suggesting they act at an alternative Site II.

Example 18

An Assay to Indirectly Measure the Interaction of Site II Ligands with GR

In order to measure the binding of putative Site II compounds to GR we utilized the Glucocorticoid receptor competitor assay kit (Panvera Co., Madison, Wis.) in a modified version of the FITC-dexamethasone fluorescence polarization assaydescribed in Example 2. In this assay, Compound D was added at a concentration of 200 nM, which yields approximately 50% inhibition of FITC-dexamethasone binding. Compound D (an R enantiomer) is Compound 50 of Example 1. Compound D is a ligand of SiteII that inhibits via Site II FITC-dexamethasone binding to GR. To the mixture of cell lysate containing the glucocorticoid receptor, Compound D, and FITC-dexamethasone, various competitor Site II ligands which do not inhibit dexamethasone binding wereadded and the change in FITC-dexamethasone binding was measured. These competitor Site II ligands, all compounds of Example 1 and all S enantiomers, were: Compound A; Compound C, which is the S enantiomer of Compound D; and Compound E, yet another Senantiomer of Example 1. If the competitor compound binds to Site II and displaces Compound D, then FITC-dexamethasone should rebind to GR. As shown in FIG. 10, the competitor compounds are effective at displacing Compound D and allowingFITC-dexamethasone to rebind to GR. This assay can therefore measure the relative binding of compounds to the Site II on GR.

Example 19

Site II Ligands Act in a GR Dependent Fashion to Repress AP-1 Driven Transcription

In order to determine whether the Site II ligands act via GR, COS cells, which do not express GR, were transfected with an AP-1 luciferase reporter (pAP-1-Luc plasmid, Stratagene, La Jolla, Calif.) plus or minus an expression construct for fulllength human GR. AP-1 activity was measured via luciferase reporter activity as described in Example 3. When GR was not present, neither 1 micromolar dexamethasone nor 40 micromolar Compound A significantly inhibited AP-1 activity. However, when GRwas transfected into the cell, both dexamethasone and Compound A suppressed AP-1 activity. These results are shown in FIGS. 11a and 11b, in which the Y axis is relative light units (RLU). These data show that both of these ligands act in a GR dependentfashion.

Example 20

Provision of GR Site II X-ray Structure Coordinates and Calculations of rms

The GR Site II x-ray structure coordinates were discerned from the disclosure in WO 03/015692 A2, Feb. 27, 2003, Apolito, et. al. and are provided in Table IV under the heading for Example 23. Apolito discloses x-ray structure coordinates of GRLBD, but does not disclose the existence or identity of Site II.

The GR Site II x-ray structure coordinates were discerned from the disclosure in Kauppi et. al., in the Journal of Biological Chemistry Online, JBC Papers In Press as DOI:10.1074/jbc.M212711200, Apr. 9, 2003, RCSB file: 1nhz.pdb (GR LBD bound toan antagonist, RU 486) and are provided in Table V under the heading for Example 24. Kauppi discloses x-ray structure coordinates of GR LBD, but does not disclose the existence or identity of Site II.

The homology model GR Site II coordinates of Table I were compared to the Site II coordinates available from the disclosures in WO 03/015692 A2, Feb. 27, 2003 Apolito, et. al. and those published by Kauppi et. al., in the Journal of BiologicalChemistry Online, JBC Papers In Press as DOI:10.1074/jbc.M212711200, Apr. 9, 2003, RCSB file: 1nhz.pdb (GR LBD bound to an antagonist, RU 486). When the backbone atoms of the homology model Site II residues, ie, E537-V543, L566, G567, Q570-W577,S599-A607, W610, R611, R614, Q615, P625, Y663, L664 and K667 of SEQ ID NO:13 according to Table I were compared, root mean square deviations (rmsds) of 0.92 and 1.02 .ANG. were obtained between the homology model of Table I Site II residues and theApolito Site II residues, and between the homology model of Table I Site II residues and the Kauppi Site II residues, respectively. In both instances the Site II residues were first overlaid using the structure overlay option within the ICM (Version3.0.017, Molsoft. LLC) modeling software. Using the rmslig program within the Flo (Colin McMartin, Thistlesoft) molecular modeling program afforded backbone rmsd calculations. These observations underscore the similarity of the Site II homology modelstructure to actual crystal structures.

Example 21

Structure Coordinates of GR LBD, Table I

Below is Table I, which gives the three-dimensional structure coordinates of the GR LBD homology model. The format used is based on that commonly used in the RCSB (Research Collaboratory for Structural Bioinformatics, pdb file format), and thefields listed from left to right are defined as follows: record name, atom serial number, atom name, residue name, chain identifier, residue sequence number, orthogonal coordinate for x in .ANG.ngstroms, orthogonal cordinate for y in .ANG.ngstroms,orthogonal coordinate for z in .ANG.ngstroms, occupancy, and temperature factor.

TABLE-US-00007 TABLE I GR Homology Model Coordinates ATOM 1 N ALA A 523 29.896 -1.364 107.714 1.00 0.00 ATOM 5 CA ALA A 523 30.095 -0.736 106.398 1.00 0.00 ATOM 6 CB ALA A 523 31.574 -0.448 106.160 1.00 0.00 ATOM 7 C ALA A 523 29.565 -1.627105.280 1.00 0.00 ATOM 8 O ALA A 523 29.626 -2.860 105.361 1.00 0.00 ATOM 9 N THR A 524 29.027 -0.987 104.257 1.00 0.00 ATOM 11 CA THR A 524 28.493 -1.717 103.105 1.00 0.00 ATOM 12 CB THR A 524 27.666 -0.754 102.257 1.00 0.00 ATOM 13 OG1 THR A 524 27.383-1.389 101.016 1.00 0.00 ATOM 14 CG2 THR A 524 28.428 0.532 101.951 1.00 0.00 ATOM 15 C THR A 524 29.607 -2.329 102.263 1.00 0.00 ATOM 16 O THR A 524 30.663 -1.720 102.058 1.00 0.00 ATOM 17 N LEU A 525 29.370 -3.559 101.836 1.00 0.00 ATOM 19 CA LEU A 52530.275 -4.243 100.909 1.00 0.00 ATOM 20 CB LEU A 525 29.686 -5.626 100.629 1.00 0.00 ATOM 21 CG LEU A 525 30.626 -6.524 99.829 1.00 0.00 ATOM 22 CD1 LEU A 525 31.867 -6.870 100.645 1.00 0.00 ATOM 23 CD2 LEU A 525 29.912 -7.799 99.399 1.00 0.00 ATOM 24 CLEU A 525 30.360 -3.442 99.612 1.00 0.00 ATOM 25 O LEU A 525 29.329 -3.065 99.040 1.00 0.00 ATOM 26 N PRO A 526 31.578 -3.090 99.231 1.00 0.00 ATOM 27 CA PRO A 526 31.804 -2.331 98.002 1.00 0.00 ATOM 28 CB PRO A 526 33.272 -2.040 97.977 1.00 0.00 ATOM29 CG PRO A 526 33.936 -2.705 99.171 1.00 0.00 ATOM 30 CD PRO A 526 32.819 -3.379 99.951 1.00 0.00 ATOM 31 C PRO A 526 31.377 -3.118 96.771 1.00 0.00 ATOM 32 O PRO A 526 31.487 -4.348 96.713 1.00 0.00 ATOM 33 N GLN A 527 30.814 -2.387 95.828 1.00 0.00ATOM 35 CA GLN A 527 30.403 -2.963 94.547 1.00 0.00 ATOM 36 CB GLN A 527 29.511 -1.931 93.859 1.00 0.00 ATOM 37 CG GLN A 527 28.265 -2.549 93.224 1.00 0.00 ATOM 38 CD GLN A 527 28.482 -2.831 91.742 1.00 0.00 ATOM 39 OE1 GLN A 527 29.078 -3.849 91.3621.00 0.00 ATOM 40 NE2 GLN A 527 28.005 -1.911 90.924 1.00 0.00 ATOM 43 C GLN A 527 31.655 -3.268 93.726 1.00 0.00 ATOM 44 O GLN A 527 32.671 -2.574 93.856 1.00 0.00 ATOM 45 N LEU A 528 31.578 -4.294 92.894 1.00 0.00 ATOM 47 CA LEU A 528 32.746 -4.72392.118 1.00 0.00 ATOM 48 CB LEU A 528 32.560 -6.180 91.716 1.00 0.00 ATOM 49 CG LEU A 528 32.452 -7.090 92.933 1.00 0.00 ATOM 50 CD1 LEU A 528 32.112 -8.515 92.513 1.00 0.00 ATOM 51 CD2 LEU A 528 33.737 -7.059 93.757 1.00 0.00 ATOM 52 C LEU A 528 32.898-3.866 90.870 1.00 0.00 ATOM 53 O LEU A 528 33.997 -3.721 90.325 1.00 0.00 ATOM 54 N THR A 529 31.794 -3.278 90.447 1.00 0.00 ATOM 56 CA THR A 529 31.839 -2.254 89.408 1.00 0.00 ATOM 57 CB THR A 529 30.592 -2.393 88.540 1.00 0.00 ATOM 58 OG1 THR A 52930.607 -3.688 87.958 1.00 0.00 ATOM 59 CG2 THR A 529 30.539 -1.366 87.417 1.00 0.00 ATOM 60 C THR A 529 31.883 -0.884 90.076 1.00 0.00 ATOM 61 O THR A 529 30.909 -0.470 90.718 1.00 0.00 ATOM 62 N PRO A 530 32.993 -0.185 89.887 1.00 0.00 ATOM 63 CA PRO A530 33.234 1.104 90.544 1.00 0.00 ATOM 64 CB PRO A 530 34.571 1.567 90.055 1.00 0.00 ATOM 65 CG PRO A 530 35.165 0.505 89.148 1.00 0.00 ATOM 66 CD PRO A 530 34.140 -0.613 89.089 1.00 0.00 ATOM 67 C PRO A 530 32.150 2.125 90.236 1.00 0.00 ATOM 68 O PRO A530 31.449 2.042 89.216 1.00 0.00 ATOM 69 N THR A 531 32.129 3.169 91.045 1.00 0.00 ATOM 71 CA THR A 531 31.052 4.162 90.968 1.00 0.00 ATOM 72 CB THR A 531 31.140 5.085 92.180 1.00 0.00 ATOM 73 OG1 THR A 531 32.362 5.809 92.114 1.00 0.00 ATOM 74 CG2 THRA 531 31.111 4.300 93.487 1.00 0.00 ATOM 75 C THR A 531 31.073 5.007 89.695 1.00 0.00 ATOM 76 O THR A 531 29.993 5.350 89.210 1.00 0.00 ATOM 77 N LEU A 532 32.208 5.125 89.025 1.00 0.00 ATOM 79 CA LEU A 532 32.214 5.894 87.780 1.00 0.00 ATOM 80 CB LEU A532 33.573 6.565 87.618 1.00 0.00 ATOM 81 CG LEU A 532 33.609 7.529 86.435 1.00 0.00 ATOM 82 CD1 LEU A 532 32.501 8.573 86.536 1.00 0.00 ATOM 83 CD2 LEU A 532 34.970 8.206 86.334 1.00 0.00 ATOM 84 C LEU A 532 31.877 5.010 86.577 1.00 0.00 ATOM 85 O LEUA 532 31.237 5.497 85.639 1.00 0.00 ATOM 86 N VAL A 533 32.020 3.701 86.726 1.00 0.00 ATOM 88 CA VAL A 533 31.635 2.801 85.633 1.00 0.00 ATOM 89 CB VAL A 533 32.392 1.482 85.741 1.00 0.00 ATOM 90 CG1 VAL A 533 31.996 0.549 84.604 1.00 0.00 ATOM 91 CG2VAL A 533 33.898 1.695 85.730 1.00 0.00 ATOM 92 C VAL A 533 30.137 2.530 85.710 1.00 0.00 ATOM 93 O VAL A 533 29.442 2.546 84.686 1.00 0.00 ATOM 94 N SER A 534 29.623 2.561 86.929 1.00 0.00 ATOM 96 CA SER A 534 28.178 2.440 87.121 1.00 0.00 ATOM 97 CBSER A 534 27.893 1.973 88.547 1.00 0.00 ATOM 98 OG SER A 534 28.439 2.917 89.458 1.00 0.00 ATOM 99 C SER A 534 27.479 3.769 86.836 1.00 0.00 ATOM 100 O SER A 534 26.379 3.756 86.274 1.00 0.00 ATOM 101 N LEU A 535 28.220 4.863 86.926 1.00 0.00 ATOM 103 CALEU A 535 27.688 6.171 86.543 1.00 0.00 ATOM 104 CB LEU A 535 28.623 7.247 87.101 1.00 0.00 ATOM 105 CG LEU A 535 28.050 8.665 87.076 1.00 0.00 ATOM 106 CD1 LEU A 535 28.691 9.518 88.164 1.00 0.00 ATOM 107 CD2 LEU A 535 28.186 9.346 85.717 1.00 0.00ATOM 108 C LEU A 535 27.595 6.254 85.025 1.00 0.00 ATOM 109 O LEU A 535 26.532 6.638 84.525 1.00 0.00 ATOM 110 N LEU A 536 28.530 5.617 84.333 1.00 0.00 ATOM 112 CA LEU A 536 28.472 5.531 82.867 1.00 0.00 ATOM 113 CB LEU A 536 29.718 4.810 82.361 1.000.00 ATOM 114 CG LEU A 536 30.987 5.631 82.524 1.00 0.00 ATOM 115 CD1 LEU A 536 32.223 4.782 82.252 1.00 0.00 ATOM 116 CD2 LEU A 536 30.958 6.847 81.611 1.00 0.00 ATOM 117 C LEU A 536 27.259 4.736 82.399 1.00 0.00 ATOM 118 O LEU A 536 26.520 5.207 81.5271.00 0.00 ATOM 119 N GLU A 537 26.914 3.696 83.143 1.00 0.00 ATOM 121 CA GLU A 537 25.777 2.858 82.762 1.00 0.00 ATOM 122 CB GLU A 537 25.977 1.487 83.413 1.00 0.00 ATOM 123 CG GLU A 537 24.963 0.430 82.969 1.00 0.00 ATOM 124 CD GLU A 537 23.742 0.40783.887 1.00 0.00 ATOM 125 OE1 GLU A 537 23.842 1.014 84.946 1.00 0.00 ATOM 126 OE2 GLU A 537 22.874 -0.419 83.642 1.00 0.00 ATOM 127 C GLU A 537 24.435 3.482 83.158 1.00 0.00 ATOM 128 O GLU A 537 23.419 3.143 82.541 1.00 0.00 ATOM 129 N VAL A 538 24.4414.447 84.063 1.00 0.00 ATOM 131 CA VAL A 538 23.200 5.129 84.441 1.00 0.00 ATOM 132 CB VAL A 538 23.276 5.436 85.937 1.00 0.00 ATOM 133 CG1 VAL A 538 22.137 6.333 86.412 1.00 0.00 ATOM 134 CG2 VAL A 538 23.303 4.148 86.754 1.00 0.00 ATOM 135 C VAL A 53822.971 6.409 83.627 1.00 0.00 ATOM 136 O VAL A 538 21.821 6.826 83.441 1.00 0.00 ATOM 137 N ILE A 539 24.032 6.969 83.066 1.00 0.00 ATOM 139 CA ILE A 539 23.872 8.155 82.212 1.00 0.00 ATOM 140 CB ILE A 539 24.957 9.187 82.534 1.00 0.00 ATOM 141 CG2 ILE A539 24.796 9.679 83.968 1.00 0.00 ATOM 142 CG1 ILE A 539 26.386 8.700 82.303 1.00 0.00 ATOM 143 CD1 ILE A 539 26.921 9.060 80.923 1.00 0.00 ATOM 144 C ILE A 539 23.823 7.782 80.730 1.00 0.00 ATOM 145 O ILE A 539 23.623 8.644 79.864 1.00 0.00 ATOM 146 NGLU A 540 24.011 6.501 80.459 1.00 0.00 ATOM 148 CA GLU A 540 23.833 5.941 79.118 1.00 0.00 ATOM 149 CB GLU A 540 24.149 4.449 79.241 1.00 0.00 ATOM 150 CG GLU A 540 24.286 3.751 77.894 1.00 0.00 ATOM 151 CD GLU A 540 25.492 4.312 77.147 1.00 0.00 ATOM152 OE1 GLU A 540 26.468 4.639 77.809 1.00 0.00 ATOM 153 OE2 GLU A 540 25.402 4.442 75.935 1.00 0.00 ATOM 154 C GLU A 540 22.386 6.135 78.651 1.00 0.00 ATOM 155 O GLU A 540 21.446 5.834 79.392 1.00 0.00 ATOM 156 N PRO A 541 22.224 6.667 77.448 1.00 0.00ATOM 157 CA PRO A 541 20.897 6.933 76.878 1.00 0.00 ATOM 158 CB PRO A 541 21.149 7.770 75.662 1.00 0.00 ATOM 159 CG PRO A 541 22.646 7.839 75.408 1.00 0.00 ATOM 160 CD PRO A 541 23.303 7.091 76.556 1.00 0.00 ATOM 161 C PRO A 541 20.126 5.663 76.507 1.000.00 ATOM 162 O PRO A 541 20.275 4.595 77.113 1.00 0.00 ATOM 163 N GLU A 542 19.264 5.827 75.519 1.00 0.00 ATOM 165 CA GLU A 542 18.347 4.761 75.107 1.00 0.00 ATOM 166 CB GLU A 542 16.936 5.359 75.169 1.00 0.00 ATOM 167 CG GLU A 542 15.810 4.352 74.9401.00 0.00 ATOM 168 CD GLU A 542 15.851 3.251 75.999 1.00 0.00 ATOM 169 OE1 GLU A 542 15.282 3.461 77.059 1.00 0.00 ATOM 170 OE2 GLU A 542 16.528 2.260 75.754 1.00 0.00 ATOM 171 C GLU A 542 18.670 4.273 73.692 1.00 0.00 ATOM 172 O GLU A 542 19.133 5.06072.858 1.00 0.00 ATOM 173 N VAL A 543 18.490 2.980 73.457 1.00 0.00 ATOM 175 CA VAL A 543 18.560 2.443 72.092 1.00 0.00 ATOM 176 CB VAL A 543 18.459 0.915 72.140 1.00 0.00 ATOM 177 CG1 VAL A 543 17.202 0.440 72.862 1.00 0.00 ATOM 178 CG2 VAL A 543 18.5540.286 70.753 1.00 0.00 ATOM 179 C VAL A 543 17.420 3.067 71.284 1.00 0.00 ATOM 180 O VAL A 543 16.281 3.174 71.755 1.00 0.00 ATOM 181 N LEU A 544 17.781 3.629 70.145 1.00 0.00 ATOM 183 CA LEU A 544 16.825 4.430 69.382 1.00 0.00 ATOM 184 CB LEU A 54417.562 5.656 68.864 1.00 0.00 ATOM 185 CG LEU A 544 18.042 6.512 70.029 1.00 0.00 ATOM 186 CD1 LEU A 544 19.047 7.556 69.573 1.00 0.00 ATOM 187 CD2 LEU A 544 16.872 7.155 70.766 1.00 0.00 ATOM 188 C LEU A 544 16.180 3.683 68.227 1.00 0.00 ATOM 189 O LEUA 544 16.693 2.676 67.728 1.00 0.00 ATOM 190 N TYR A 545 14.965 4.108 67.936 1.00 0.00 ATOM 192 CA TYR A 545 14.260 3.652 66.740 1.00 0.00 ATOM 193 CB TYR A 545 12.757 3.789 66.965 1.00 0.00 ATOM 194 CG TYR A 545 12.247 3.056 68.206 1.00 0.00 ATOM 195CD1 TYR A 545 11.731 3.778 69.276 1.00 0.00 ATOM 196 CE1 TYR A 545 11.275 3.116 70.408 1.00 0.00 ATOM 197 CZ TYR A 545 11.333 1.730 70.467 1.00 0.00 ATOM 198 OH TYR A 545 10.913 1.073 71.603 1.00 0.00 ATOM 199 CE2 TYR A 545 11.838 1.004 69.396 1.00 0.00ATOM 200 CD2 TYR A 545 12.294 1.668 68.264 1.00 0.00 ATOM 201 C TYR A 545 14.710 4.509 65.561 1.00 0.00 ATOM 202 O TYR A 545 14.930 5.715 65.709 1.00 0.00 ATOM 203 N ALA A 546 14.804 3.894 64.394 1.00 0.00 ATOM 205 CA ALA A 546 15.305 4.594 63.202 1.000.00 ATOM 206 CB ALA A 546 15.917 3.562 62.265 1.00 0.00 ATOM 207 C ALA A 546 14.225 5.362 62.447 1.00 0.00 ATOM 208 O ALA A 546 14.527 6.166 61.557 1.00 0.00 ATOM 209 N GLY A 547 12.977 5.107 62.802 1.00 0.00 ATOM 211 CA GLY A 547 11.850 5.753 62.1271.00 0.00 ATOM 212 C GLY A 547 11.509 4.995 60.851 1.00 0.00 ATOM 213 O GLY A 547 11.063 5.577 59.856 1.00 0.00 ATOM 214 N TYR A 548 11.748 3.695 60.882 1.00 0.00 ATOM 216 CA TYR A 548 11.488 2.869 59.708 1.00 0.00 ATOM 217 CB TYR A 548 12.402 1.64859.769 1.00 0.00 ATOM 218 CG TYR A 548 12.421 0.853 58.473 1.00 0.00 ATOM 219 CD1 TYR A 548 12.358 1.532 57.263 1.00 0.00 ATOM 220 CE1 TYR A 548 12.351 0.827 56.071 1.00 0.00 ATOM 221 CZ TYR A 548 12.421 -0.558 56.092 1.00 0.00 ATOM 222 OH TYR A 54812.386 -1.249 54.905 1.00 0.00 ATOM 223 CE2 TYR A 548 12.507 -1.242 57.298 1.00 0.00 ATOM 224 CD2 TYR A 548 12.509 -0.533 58.493 1.00 0.00 ATOM 225 C TYR A 548 10.018 2.457 59.680 1.00 0.00 ATOM 226 O TYR A 548 9.464 2.010 60.690 1.00 0.00 ATOM 227 N ASPA 549 9.403 2.586 58.512 1.00 0.00 ATOM 229 CA ASP A 549 7.982 2.238 58.349 1.00 0.00 ATOM 230 CB ASP A 549 7.420 2.999 57.152 1.00 0.00 ATOM 231 CG ASP A 549 7.556 4.508 57.353 1.00 0.00 ATOM 232 OD1 ASP A 549 6.803 5.048 58.149 1.00 0.00 ATOM 233 OD2ASP A 549 8.414 5.085 56.700 1.00 0.00 ATOM 234 C ASP A 549 7.753 0.735 58.152 1.00 0.00 ATOM 235 O ASP A 549 6.596 0.294 58.159 1.00 0.00 ATOM 236 N SER A 550 8.824 0.003 57.862 1.00 0.00 ATOM 238 CA SER A 550 8.898 -1.480 57.888 1.00 0.00 ATOM 239 CBSER A 550 8.434 -1.940 59.266 1.00 0.00 ATOM 240 OG SER A 550 8.472 -3.360 59.288 1.00 0.00 ATOM 241 C SER A 550 8.143 -2.292 56.818 1.00 0.00 ATOM 242 O SER A 550 8.621 -3.367 56.439 1.00 0.00 ATOM 243 N SER A 551 7.012 -1.814 56.330 1.00 0.00 ATOM 245CA SER A 551 6.255 -2.568 55.326 1.00 0.00 ATOM 246 CB SER A 551 4.779 -2.238 55.500 1.00 0.00 ATOM 247 OG SER A 551 4.424 -2.568 56.836 1.00 0.00 ATOM 248 C SER A 551 6.695 -2.216 53.912 1.00 0.00 ATOM 249 O SER A 551 6.514 -3.002 52.976 1.00 0.00 ATOM250 N VAL A 552 7.313 -1.057 53.778 1.00 0.00 ATOM 252 CA VAL A 552 7.876 -0.656 52.491 1.00 0.00 ATOM 253 CB VAL A 552 7.800 0.869 52.387 1.00 0.00 ATOM 254 CG1 VAL A 552 8.416 1.566 53.596 1.00 0.00 ATOM 255 CG2 VAL A 552 8.402 1.388 51.086 1.00 0.00ATOM 256 C VAL A 552 9.313 -1.167 52.375 1.00 0.00 ATOM 257 O VAL A 552 10.136 -0.946 53.272 1.00 0.00 ATOM 258 N PRO A 553 9.580 -1.907 51.310 1.00 0.00 ATOM 259 CA PRO A 553 10.933 -2.405 51.049 1.00 0.00 ATOM 260 CB PRO A 553 10.815 -3.246 49.816 1.000.00 ATOM 261 CG PRO A 553 9.387 -3.180 49.297 1.00 0.00 ATOM 262 CD PRO A 553 8.625 -2.294 50.269 1.00 0.00 ATOM 263 C PRO A 553 11.909 -1.251 50.850 1.00 0.00 ATOM 264 O PRO A 553 11.602 -0.258 50.179 1.00 0.00 ATOM 265 N ASP A 554 13.067 -1.37651.474 1.00 0.00 ATOM 267 CA ASP A 554 14.087 -0.329 51.374 1.00 0.00 ATOM 268 CB ASP A 554 15.171 -0.550 52.421 1.00 0.00 ATOM 269 CG ASP A 554 14.847 0.260 53.667 1.00 0.00 ATOM 270 OD1 ASP A 554 14.195 1.281 53.512 1.00 0.00 ATOM 271 OD2 ASP A 55415.249 -0.162 54.740 1.00 0.00 ATOM 272 C ASP A 554 14.761 -0.252 50.016 1.00 0.00 ATOM 273 O ASP A 554 15.494 -1.154 49.596 1.00 0.00 ATOM 274 N SER A 555 14.485 0.844 49.334 1.00 0.00 ATOM 276 CA SER A 555 15.327 1.251 48.211 1.00 0.00 ATOM 277 CB SERA 555 14.626 2.330 47.398 1.00 0.00 ATOM 278 OG SER A 555 14.660 3.522 48.172 1.00 0.00

ATOM 279 C SER A 555 16.577 1.853 48.831 1.00 0.00 ATOM 280 O SER A 555 16.568 2.154 50.032 1.00 0.00 ATOM 281 N THR A 556 17.572 2.174 48.023 1.00 0.00 ATOM 283 CA THR A 556 18.768 2.801 48.593 1.00 0.00 ATOM 284 CB THR A 556 19.911 2.769 47.5831.00 0.00 ATOM 285 OG1 THR A 556 20.919 3.637 48.084 1.00 0.00 ATOM 286 CG2 THR A 556 19.499 3.272 46.202 1.00 0.00 ATOM 287 C THR A 556 18.499 4.234 49.061 1.00 0.00 ATOM 288 O THR A 556 18.986 4.614 50.132 1.00 0.00 ATOM 289 N TRP A 557 17.501 4.87348.472 1.00 0.00 ATOM 291 CA TRP A 557 17.101 6.209 48.911 1.00 0.00 ATOM 292 CB TRP A 557 16.147 6.804 47.878 1.00 0.00 ATOM 293 CG TRP A 557 16.685 6.926 46.461 1.00 0.00 ATOM 294 CD1 TRP A 557 18.000 6.960 46.052 1.00 0.00 ATOM 295 NE1 TRP A 55718.034 7.100 44.704 1.00 0.00 ATOM 297 CE2 TRP A 557 16.792 7.152 44.193 1.00 0.00 ATOM 298 CZ2 TRP A 557 16.313 7.298 42.899 1.00 0.00 ATOM 299 CH2 TRP A 557 14.940 7.321 42.671 1.00 0.00 ATOM 300 CZ3 TRP A 557 14.050 7.198 43.732 1.00 0.00 ATOM 301 CE3TRP A 557 14.521 7.054 45.031 1.00 0.00 ATOM 302 CD2 TRP A 557 15.887 7.032 45.261 1.00 0.00 ATOM 303 C TRP A 557 16.387 6.134 50.259 1.00 0.00 ATOM 304 O TRP A 557 16.803 6.803 51.212 1.00 0.00 ATOM 305 N ARG A 558 15.517 5.145 50.411 1.00 0.00 ATOM307 CA ARG A 558 14.791 4.994 51.677 1.00 0.00 ATOM 308 CB ARG A 558 13.663 3.993 51.479 1.00 0.00 ATOM 309 CG ARG A 558 12.693 4.469 50.410 1.00 0.00 ATOM 310 CD ARG A 558 11.557 3.471 50.217 1.00 0.00 ATOM 311 NE ARG A 558 10.668 3.894 49.123 1.00 0.00ATOM 312 CZ ARG A 558 9.544 4.594 49.306 1.00 0.00 ATOM 313 NH1 ARG A 558 9.164 4.950 50.538 1.00 0.00 ATOM 314 NH2 ARG A 558 8.795 4.935 48.255 1.00 0.00 ATOM 315 C ARG A 558 15.668 4.520 52.832 1.00 0.00 ATOM 316 O ARG A 558 15.528 5.062 53.936 1.000.00 ATOM 317 N ILE A 559 16.703 3.742 52.556 1.00 0.00 ATOM 319 CA ILE A 559 17.563 3.325 53.663 1.00 0.00 ATOM 320 CB ILE A 559 18.271 2.004 53.340 1.00 0.00 ATOM 321 CG2 ILE A 559 19.157 2.093 52.105 1.00 0.00 ATOM 322 CG1 ILE A 559 19.092 1.51654.529 1.00 0.00 ATOM 323 CD1 ILE A 559 18.210 1.234 55.740 1.00 0.00 ATOM 324 C ILE A 559 18.542 4.439 54.047 1.00 0.00 ATOM 325 O ILE A 559 18.731 4.655 55.250 1.00 0.00 ATOM 326 N MET A 560 18.863 5.331 53.121 1.00 0.00 ATOM 328 CA MET A 560 19.7206.457 53.488 1.00 0.00 ATOM 329 CB MET A 560 20.376 7.042 52.243 1.00 0.00 ATOM 330 CG MET A 560 21.336 6.047 51.603 1.00 0.00 ATOM 331 SD MET A 560 22.247 6.663 50.168 1.00 0.00 ATOM 332 CE MET A 560 20.856 7.241 49.168 1.00 0.00 ATOM 333 C MET A 56018.926 7.539 54.207 1.00 0.00 ATOM 334 O MET A 560 19.406 8.049 55.224 1.00 0.00 ATOM 335 N THR A 561 17.649 7.665 53.885 1.00 0.00 ATOM 337 CA THR A 561 16.813 8.653 54.580 1.00 0.00 ATOM 338 CB THR A 561 15.599 9.005 53.725 1.00 0.00 ATOM 339 OG1 THR A561 14.891 7.812 53.416 1.00 0.00 ATOM 340 CG2 THR A 561 16.008 9.669 52.418 1.00 0.00 ATOM 341 C THR A 561 16.358 8.187 55.966 1.00 0.00 ATOM 342 O THR A 561 16.308 9.019 56.881 1.00 0.00 ATOM 343 N THR A 562 16.273 6.886 56.203 1.00 0.00 ATOM 345 CATHR A 562 15.961 6.459 57.573 1.00 0.00 ATOM 346 CB THR A 562 15.204 5.130 57.599 1.00 0.00 ATOM 347 OG1 THR A 562 14.894 4.838 58.957 1.00 0.00 ATOM 348 CG2 THR A 562 16.002 3.962 57.033 1.00 0.00 ATOM 349 C THR A 562 17.230 6.403 58.422 1.00 0.00 ATOM350 O THR A 562 17.162 6.627 59.636 1.00 0.00 ATOM 351 N LEU A 563 18.384 6.388 57.770 1.00 0.00 ATOM 353 CA LEU A 563 19.644 6.547 58.498 1.00 0.00 ATOM 354 CB LEU A 563 20.762 5.840 57.741 1.00 0.00 ATOM 355 CG LEU A 563 20.561 4.329 57.757 1.00 0.00ATOM 356 CD1 LEU A 563 21.617 3.623 56.914 1.00 0.00 ATOM 357 CD2 LEU A 563 20.559 3.794 59.184 1.00 0.00 ATOM 358 C LEU A 563 19.986 8.023 58.694 1.00 0.00 ATOM 359 O LEU A 563 20.776 8.359 59.581 1.00 0.00 ATOM 360 N ASN A 564 19.291 8.899 57.987 1.000.00 ATOM 362 CA ASN A 564 19.408 10.340 58.231 1.00 0.00 ATOM 363 CB ASN A 564 18.891 11.101 57.012 1.00 0.00 ATOM 364 CG ASN A 564 19.845 11.032 55.820 1.00 0.00 ATOM 365 OD1 ASN A 564 19.410 11.086 54.658 1.00 0.00 ATOM 366 ND2 ASN A 564 21.132 11.07256.120 1.00 0.00 ATOM 369 C ASN A 564 18.562 10.738 59.432 1.00 0.00 ATOM 370 O ASN A 564 19.003 11.535 60.274 1.00 0.00 ATOM 371 N MET A 565 17.446 10.045 59.595 1.00 0.00 ATOM 373 CA MET A 565 16.570 10.286 60.742 1.00 0.00 ATOM 374 CB MET A 565 15.2139.662 60.441 1.00 0.00 ATOM 375 CG MET A 565 14.193 10.003 61.520 1.00 0.00 ATOM 376 SD MET A 565 13.873 11.769 61.731 1.00 0.00 ATOM 377 CE MET A 565 13.319 12.168 60.056 1.00 0.00 ATOM 378 C MET A 565 17.158 9.662 62.003 1.00 0.00 ATOM 379 O MET A 56517.307 10.352 63.021 1.00 0.00 ATOM 380 N LEU A 566 17.734 8.481 61.847 1.00 0.00 ATOM 382 CA LEU A 566 18.408 7.825 62.971 1.00 0.00 ATOM 383 CB LEU A 566 18.670 6.378 62.581 1.00 0.00 ATOM 384 CG LEU A 566 19.330 5.598 63.709 1.00 0.00 ATOM 385 CD1 LEUA 566 18.467 5.589 64.967 1.00 0.00 ATOM 386 CD2 LEU A 566 19.635 4.179 63.257 1.00 0.00 ATOM 387 C LEU A 566 19.727 8.514 63.320 1.00 0.00 ATOM 388 O LEU A 566 20.020 8.674 64.510 1.00 0.00 ATOM 389 N GLY A 567 20.361 9.125 62.332 1.00 0.00 ATOM 391 CAGLY A 567 21.553 9.948 62.554 1.00 0.00 ATOM 392 C GLY A 567 21.234 11.124 63.467 1.00 0.00 ATOM 393 O GLY A 567 21.854 11.263 64.527 1.00 0.00 ATOM 394 N GLY A 568 20.165 11.840 63.150 1.00 0.00 ATOM 396 CA GLY A 568 19.707 12.956 63.986 1.00 0.00 ATOM397 C GLY A 568 19.314 12.517 65.396 1.00 0.00 ATOM 398 O GLY A 568 19.749 13.140 66.375 1.00 0.00 ATOM 399 N ARG A 569 18.646 11.378 65.501 1.00 0.00 ATOM 401 CA ARG A 569 18.287 10.823 66.814 1.00 0.00 ATOM 402 CB ARG A 569 17.431 9.576 66.607 1.000.00 ATOM 403 CG ARG A 569 16.096 9.914 65.955 1.00 0.00 ATOM 404 CD ARG A 569 15.301 10.883 66.824 1.00 0.00 ATOM 405 NE ARG A 569 14.045 11.279 66.170 1.00 0.00 ATOM 406 CZ ARG A 569 13.861 12.476 65.610 1.00 0.00 ATOM 407 NH1 ARG A 569 14.862 13.35965.576 1.00 0.00 ATOM 408 NH2 ARG A 569 12.686 12.778 65.055 1.00 0.00 ATOM 409 C ARG A 569 19.514 10.442 67.645 1.00 0.00 ATOM 410 O ARG A 569 19.581 10.806 68.826 1.00 0.00 ATOM 411 N GLN A 570 20.552 9.933 67.003 1.00 0.00 ATOM 413 CA GLN A 57021.776 9.590 67.729 1.00 0.00 ATOM 414 CB GLN A 570 22.581 8.600 66.900 1.00 0.00 ATOM 415 CG GLN A 570 21.822 7.289 66.733 1.00 0.00 ATOM 416 CD GLN A 570 22.624 6.329 65.864 1.00 0.00 ATOM 417 OE1 GLN A 570 22.360 6.182 64.665 1.00 0.00 ATOM 418 NE2GLN A 570 23.624 5.716 66.473 1.00 0.00 ATOM 421 C GLN A 570 22.630 10.813 68.041 1.00 0.00 ATOM 422 O GLN A 570 23.319 10.806 69.065 1.00 0.00 ATOM 423 N VAL A 571 22.418 11.909 67.331 1.00 0.00 ATOM 425 CA VAL A 571 23.112 13.154 67.664 1.00 0.00 ATOM426 CB VAL A 571 23.083 14.085 66.455 1.00 0.00 ATOM 427 CG1 VAL A 571 23.572 15.482 66.818 1.00 0.00 ATOM 428 CG2 VAL A 571 23.896 13.518 65.298 1.00 0.00 ATOM 429 C VAL A 571 22.462 13.844 68.858 1.00 0.00 ATOM 430 O VAL A 571 23.181 14.252 69.780 1.000.00 ATOM 431 N ILE A 572 21.149 13.728 68.986 1.00 0.00 ATOM 433 CA ILE A 572 20.496 14.356 70.137 1.00 0.00 ATOM 434 CB ILE A 572 19.057 14.749 69.756 1.00 0.00 ATOM 435 CG2 ILE A 572 18.171 13.538 69.493 1.00 0.00 ATOM 436 CG1 ILE A 572 18.387 15.66470.784 1.00 0.00 ATOM 437 CD1 ILE A 572 17.740 14.905 71.940 1.00 0.00 ATOM 438 C ILE A 572 20.613 13.460 71.378 1.00 0.00 ATOM 439 O ILE A 572 20.808 13.986 72.481 1.00 0.00 ATOM 440 N ALA A 573 20.826 12.169 71.170 1.00 0.00 ATOM 442 CA ALA A 57321.104 11.288 72.304 1.00 0.00 ATOM 443 CB ALA A 573 20.788 9.851 71.907 1.00 0.00 ATOM 444 C ALA A 573 22.564 11.389 72.735 1.00 0.00 ATOM 445 O ALA A 573 22.844 11.360 73.939 1.00 0.00 ATOM 446 N ALA A 574 23.431 11.768 71.809 1.00 0.00 ATOM 448 CA ALAA 574 24.844 11.946 72.137 1.00 0.00 ATOM 449 CB ALA A 574 25.679 11.832 70.868 1.00 0.00 ATOM 450 C ALA A 574 25.115 13.288 72.800 1.00 0.00 ATOM 451 O ALA A 574 25.967 13.344 73.691 1.00 0.00 ATOM 452 N VAL A 575 24.280 14.287 72.556 1.00 0.00 ATOM 454CA VAL A 575 24.466 15.544 73.284 1.00 0.00 ATOM 455 CB VAL A 575 23.973 16.736 72.457 1.00 0.00 ATOM 456 CG1 VAL A 575 22.492 16.662 72.109 1.00 0.00 ATOM 457 CG2 VAL A 575 24.283 18.056 73.154 1.00 0.00 ATOM 458 C VAL A 575 23.794 15.479 74.657 1.000.00 ATOM 459 O VAL A 575 24.335 16.042 75.617 1.00 0.00 ATOM 460 N LYS A 576 22.851 14.561 74.817 1.00 0.00 ATOM 462 CA LYS A 576 22.260 14.340 76.136 1.00 0.00 ATOM 463 CB LYS A 576 20.923 13.631 75.954 1.00 0.00 ATOM 464 CG LYS A 576 20.179 13.49577.277 1.00 0.00 ATOM 465 CD LYS A 576 19.845 14.863 77.866 1.00 0.00 ATOM 466 CE LYS A 576 18.933 15.661 76.940 1.00 0.00 ATOM 467 NZ LYS A 576 18.649 16.992 77.502 1.00 0.00 ATOM 468 C LYS A 576 23.192 13.489 76.996 1.00 0.00 ATOM 469 O LYS A 57623.433 13.827 78.161 1.00 0.00 ATOM 470 N TRP A 577 23.921 12.600 76.341 1.00 0.00 ATOM 472 CA TRP A 577 24.933 11.783 77.016 1.00 0.00 ATOM 473 CB TRP A 577 25.275 10.636 76.070 1.00 0.00 ATOM 474 CG TRP A 577 26.408 9.734 76.514 1.00 0.00 ATOM 475 CD1TRP A 577 26.335 8.699 77.416 1.00 0.00 ATOM 476 NE1 TRP A 577 27.566 8.143 77.534 1.00 0.00 ATOM 478 CE2 TRP A 577 28.459 8.765 76.744 1.00 0.00 ATOM 479 CZ2 TRP A 577 29.818 8.580 76.527 1.00 0.00 ATOM 480 CH2 TRP A 577 30.489 9.395 75.623 1.00 0.00ATOM 481 CZ3 TRP A 577 29.809 10.396 74.939 1.00 0.00 ATOM 482 CE3 TRP A 577 28.451 10.596 75.156 1.00 0.00 ATOM 483 CD2 TRP A 577 27.778 9.786 76.059 1.00 0.00 ATOM 484 C TRP A 577 26.189 12.595 77.335 1.00 0.00 ATOM 485 O TRP A 577 26.751 12.448 78.4271.00 0.00 ATOM 486 N ALA A 578 26.443 13.617 76.534 1.00 0.00 ATOM 488 CA ALA A 578 27.569 14.521 76.777 1.00 0.00 ATOM 489 CB ALA A 578 27.869 15.253 75.477 1.00 0.00 ATOM 490 C ALA A 578 27.265 15.526 77.887 1.00 0.00 ATOM 491 O ALA A 578 28.163 15.90978.642 1.00 0.00 ATOM 492 N LYS A 579 25.986 15.774 78.112 1.00 0.00 ATOM 494 CA LYS A 579 25.557 16.603 79.243 1.00 0.00 ATOM 495 CB LYS A 579 24.318 17.406 78.849 1.00 0.00 ATOM 496 CG LYS A 579 24.591 18.882 78.523 1.00 0.00 ATOM 497 CD LYS A 57925.272 19.154 77.177 1.00 0.00 ATOM 498 CE LYS A 579 26.797 19.067 77.221 1.00 0.00 ATOM 499 NZ LYS A 579 27.364 20.023 78.184 1.00 0.00 ATOM 500 C LYS A 579 25.264 15.765 80.489 1.00 0.00 ATOM 501 O LYS A 579 24.777 16.293 81.496 1.00 0.00 ATOM 502 NALA A 580 25.488 14.466 80.394 1.00 0.00 ATOM 504 CA ALA A 580 25.344 13.584 81.548 1.00 0.00 ATOM 505 CB ALA A 580 24.418 12.440 81.155 1.00 0.00 ATOM 506 C ALA A 580 26.699 13.040 81.996 1.00 0.00 ATOM 507 O ALA A 580 26.812 12.466 83.087 1.00 0.00ATOM 508 N ILE A 581 27.712 13.222 81.164 1.00 0.00 ATOM 510 CA ILE A 581 29.057 12.754 81.513 1.00 0.00 ATOM 511 CB ILE A 581 29.733 12.233 80.235 1.00 0.00 ATOM 512 CG2 ILE A 581 29.876 13.305 79.168 1.00 0.00 ATOM 513 CG1 ILE A 581 31.085 11.59480.507 1.00 0.00 ATOM 514 CD1 ILE A 581 30.914 10.291 81.274 1.00 0.00 ATOM 515 C ILE A 581 29.872 13.854 82.211 1.00 0.00 ATOM 516 O ILE A 581 30.131 14.936 81.664 1.00 0.00 ATOM 517 N PRO A 582 30.282 13.547 83.432 1.00 0.00 ATOM 518 CA PRO A 58231.176 14.428 84.187 1.00 0.00 ATOM 519 CB PRO A 582 31.409 13.739 85.496 1.00 0.00 ATOM 520 CG PRO A 582 30.686 12.401 85.493 1.00 0.00 ATOM 521 CD PRO A 582 29.980 12.307 84.151 1.00 0.00 ATOM 522 C PRO A 582 32.481 14.642 83.430 1.00 0.00 ATOM 523 OPRO A 582 32.879 13.809 82.607 1.00 0.00 ATOM 524 N GLY A 583 33.036 15.832 83.566 1.00 0.00 ATOM 526 CA GLY A 583 34.260 16.168 82.837 1.00 0.00 ATOM 527 C GLY A 583 33.958 16.979 81.579 1.00 0.00 ATOM 528 O GLY A 583 34.499 18.078 81.396 1.00 0.00 ATOM529 N PHE A 584 33.011 16.502 80.783 1.00 0.00 ATOM 531 CA PHE A 584 32.704 17.165 79.513 1.00 0.00 ATOM 532 CB PHE A 584 31.836 16.235 78.682 1.00 0.00 ATOM 533 CG PHE A 584 31.544 16.728 77.270 1.00 0.00 ATOM 534 CD1 PHE A 584 32.456 16.481 76.254 1.000.00 ATOM 535 CE1 PHE A 584 32.187 16.910 74.962 1.00 0.00 ATOM 536 CZ PHE A 584 31.011 17.593 74.688 1.00 0.00 ATOM 537 CE2 PHE A 584 30.109 17.860 75.708 1.00 0.00 ATOM 538 CD2 PHE A 584 30.377 17.430 77.001 1.00 0.00 ATOM 539 C PHE A 584 31.976 18.47879.752 1.00 0.00 ATOM 540 O PHE A 584 32.399 19.506 79.207 1.00 0.00 ATOM 541 N ARG A 585 31.186 18.502 80.814 1.00 0.00 ATOM 543 CA ARG A 585 30.507 19.733 81.240 1.00 0.00 ATOM 544 CB ARG A 585 29.345 19.333 82.131 1.00 0.00 ATOM 545 CG ARG A 58528.432 18.343 81.426 1.00 0.00 ATOM 546 CD ARG A 585 27.286 17.947 82.343 1.00 0.00 ATOM 547 NE ARG A 585 27.795 17.323 83.574 1.00 0.00 ATOM 548 CZ ARG A 585 27.390 17.697 84.789 1.00 0.00 ATOM 549 NH1 ARG A 585 26.498 18.681 84.920 1.00 0.00 ATOM 550NH2 ARG A 585 27.886 17.096 85.873 1.00 0.00 ATOM 551 C ARG A 585 31.414 20.686 82.026 1.00 0.00 ATOM 552 O ARG A 585 30.976 21.769 82.426 1.00 0.00 ATOM 553 N ASN A 586 32.657 20.285 82.241 1.00 0.00 ATOM 555 CA ASN A 586 33.616 21.107 82.973 1.00 0.00ATOM 556 CB ASN A 586 34.311 20.210 83.992 1.00 0.00 ATOM 557 CG ASN A 586 33.266 19.620 84.938 1.00 0.00 ATOM 558 OD1 ASN A 586 32.806 18.480 84.772 1.00 0.00 ATOM 559 ND2 ASN A 586 32.846 20.442 85.882 1.00 0.00 ATOM 562 C ASN A 586 34.619 21.71781.997 1.00 0.00 ATOM 563 O ASN A 586 35.348 22.658 82.337 1.00 0.00 ATOM 564 N LEU A 587 34.618 21.187 80.783 1.00 0.00 ATOM 566 CA LEU A 587 35.398 21.759 79.679 1.00 0.00 ATOM 567 CB LEU A 587 35.372 20.789 78.503 1.00 0.00 ATOM 568 CG LEU A 58736.045 19.467 78.838 1.00 0.00

ATOM 569 CD1 LEU A 587 35.842 18.453 77.720 1.00 0.00 ATOM 570 CD2 LEU A 587 37.526 19.678 79.110 1.00 0.00 ATOM 571 C LEU A 587 34.792 23.075 79.216 1.00 0.00 ATOM 572 O LEU A 587 33.635 23.381 79.521 1.00 0.00 ATOM 573 N HIS A 588 35.584 23.84678.490 1.00 0.00 ATOM 575 CA HIS A 588 35.078 25.082 77.877 1.00 0.00 ATOM 576 CB HIS A 588 36.258 25.795 77.222 1.00 0.00 ATOM 577 CG HIS A 588 35.913 27.059 76.463 1.00 0.00 ATOM 578 ND1 HIS A 588 36.161 27.298 75.163 1.00 0.00 ATOM 580 CE1 HIS A 58835.694 28.526 74.849 1.00 0.00 ATOM 581 NE2 HIS A 588 35.158 29.064 75.965 1.00 0.00 ATOM 582 CD2 HIS A 588 35.292 28.175 76.973 1.00 0.00 ATOM 583 C HIS A 588 33.995 24.730 76.853 1.00 0.00 ATOM 584 O HIS A 588 34.136 23.734 76.133 1.00 0.00 ATOM 585 NLEU A 589 32.998 25.592 76.706 1.00 0.00 ATOM 587 CA LEU A 589 31.819 25.293 75.877 1.00 0.00 ATOM 588 CB LEU A 589 30.798 26.405 76.119 1.00 0.00 ATOM 589 CG LEU A 589 29.468 26.173 75.404 1.00 0.00 ATOM 590 CD1 LEU A 589 28.292 26.500 76.318 1.00 0.00ATOM 591 CD2 LEU A 589 29.373 26.957 74.097 1.00 0.00 ATOM 592 C LEU A 589 32.119 25.144 74.382 1.00 0.00 ATOM 593 O LEU A 589 31.635 24.185 73.770 1.00 0.00 ATOM 594 N ASP A 590 33.128 25.841 73.881 1.00 0.00 ATOM 596 CA ASP A 590 33.489 25.662 72.4661.00 0.00 ATOM 597 CB ASP A 590 34.272 26.871 71.966 1.00 0.00 ATOM 598 CG ASP A 590 33.418 28.137 72.020 1.00 0.00 ATOM 599 OD1 ASP A 590 32.206 28.017 71.906 1.00 0.00 ATOM 600 OD2 ASP A 590 33.989 29.191 72.256 1.00 0.00 ATOM 601 C ASP A 590 34.31324.390 72.254 1.00 0.00 ATOM 602 O ASP A 590 34.208 23.760 71.194 1.00 0.00 ATOM 603 N ASP A 591 34.855 23.863 73.341 1.00 0.00 ATOM 605 CA ASP A 591 35.599 22.607 73.273 1.00 0.00 ATOM 606 CB ASP A 591 36.581 22.508 74.432 1.00 0.00 ATOM 607 CG ASP A591 37.570 23.665 74.440 1.00 0.00 ATOM 608 OD1 ASP A 591 37.852 24.229 73.392 1.00 0.00 ATOM 609 OD2 ASP A 591 38.072 23.970 75.512 1.00 0.00 ATOM 610 C ASP A 591 34.624 21.448 73.385 1.00 0.00 ATOM 611 O ASP A 591 34.844 20.408 72.759 1.00 0.00 ATOM612 N GLN A 592 33.473 21.710 73.984 1.00 0.00 ATOM 614 CA GLN A 592 32.406 20.714 74.060 1.00 0.00 ATOM 615 CB GLN A 592 31.336 21.222 75.015 1.00 0.00 ATOM 616 CG GLN A 592 31.875 21.427 76.421 1.00 0.00 ATOM 617 CD GLN A 592 30.825 22.143 77.264 1.000.00 ATOM 618 OE1 GLN A 592 29.914 22.790 76.735 1.00 0.00 ATOM 619 NE2 GLN A 592 30.989 22.043 78.568 1.00 0.00 ATOM 622 C GLN A 592 31.776 20.539 72.690 1.00 0.00 ATOM 623 O GLN A 592 31.686 19.408 72.189 1.00 0.00 ATOM 624 N MET A 593 31.592 21.66272.013 1.00 0.00 ATOM 626 CA MET A 593 31.067 21.654 70.647 1.00 0.00 ATOM 627 CB MET A 593 30.972 23.090 70.151 1.00 0.00 ATOM 628 CG MET A 593 29.986 23.908 70.975 1.00 0.00 ATOM 629 SD MET A 593 29.862 25.647 70.499 1.00 0.00 ATOM 630 CE MET A 59329.469 25.427 68.748 1.00 0.00 ATOM 631 C MET A 593 31.986 20.873 69.722 1.00 0.00 ATOM 632 O MET A 593 31.611 19.767 69.308 1.00 0.00 ATOM 633 N THR A 594 33.252 21.260 69.701 1.00 0.00 ATOM 635 CA THR A 594 34.221 20.615 68.803 1.00 0.00 ATOM 636 CBTHR A 594 35.519 21.417 68.818 1.00 0.00 ATOM 637 OG1 THR A 594 35.986 21.505 70.160 1.00 0.00 ATOM 638 CG2 THR A 594 35.308 22.832 68.291 1.00 0.00 ATOM 639 C THR A 594 34.532 19.161 69.161 1.00 0.00 ATOM 640 O THR A 594 34.664 18.345 68.243 1.00 0.00ATOM 641 N LEU A 595 34.388 18.783 70.419 1.00 0.00 ATOM 643 CA LEU A 595 34.655 17.401 70.820 1.00 0.00 ATOM 644 CB LEU A 595 34.707 17.349 72.337 1.00 0.00 ATOM 645 CG LEU A 595 36.035 16.810 72.841 1.00 0.00 ATOM 646 CD1 LEU A 595 37.207 17.620 72.2971.00 0.00 ATOM 647 CD2 LEU A 595 36.047 16.782 74.363 1.00 0.00 ATOM 648 C LEU A 595 33.548 16.476 70.345 1.00 0.00 ATOM 649 O LEU A 595 33.821 15.528 69.594 1.00 0.00 ATOM 650 N LEU A 596 32.317 16.934 70.504 1.00 0.00 ATOM 652 CA LEU A 596 31.16816.125 70.099 1.00 0.00 ATOM 653 CB LEU A 596 29.917 16.724 70.731 1.00 0.00 ATOM 654 CG LEU A 596 28.678 15.888 70.432 1.00 0.00 ATOM 655 CD1 LEU A 596 28.811 14.485 71.015 1.00 0.00 ATOM 656 CD2 LEU A 596 27.427 16.570 70.970 1.00 0.00 ATOM 657 C LEU A596 31.020 16.111 68.582 1.00 0.00 ATOM 658 O LEU A 596 30.764 15.046 68.007 1.00 0.00 ATOM 659 N GLN A 597 31.458 17.181 67.940 1.00 0.00 ATOM 661 CA GLN A 597 31.401 17.246 66.482 1.00 0.00 ATOM 662 CB GLN A 597 31.509 18.709 66.071 1.00 0.00 ATOM 663CG GLN A 597 30.300 19.504 66.547 1.00 0.00 ATOM 664 CD GLN A 597 30.469 20.978 66.197 1.00 0.00 ATOM 665 OE1 GLN A 597 31.241 21.709 66.833 1.00 0.00 ATOM 666 NE2 GLN A 597 29.741 21.399 65.177 1.00 0.00 ATOM 669 C GLN A 597 32.514 16.446 65.808 1.000.00 ATOM 670 O GLN A 597 32.279 15.884 64.735 1.00 0.00 ATOM 671 N TYR A 598 33.628 16.229 66.483 1.00 0.00 ATOM 673 CA TYR A 598 34.695 15.440 65.861 1.00 0.00 ATOM 674 CB TYR A 598 36.050 15.808 66.465 1.00 0.00 ATOM 675 CG TYR A 598 36.616 17.20566.194 1.00 0.00 ATOM 676 CD1 TYR A 598 35.993 18.095 65.326 1.00 0.00 ATOM 677 CE1 TYR A 598 36.538 19.353 65.107 1.00 0.00 ATOM 678 CZ TYR A 598 37.709 19.718 65.755 1.00 0.00 ATOM 679 OH TYR A 598 38.266 20.957 65.529 1.00 0.00 ATOM 680 CE2 TYR A 59838.333 18.834 66.622 1.00 0.00 ATOM 681 CD2 TYR A 598 37.786 17.578 66.841 1.00 0.00 ATOM 682 C TYR A 598 34.467 13.954 66.103 1.00 0.00 ATOM 683 O TYR A 598 34.723 13.121 65.224 1.00 0.00 ATOM 684 N SER A 599 33.841 13.653 67.227 1.00 0.00 ATOM 686 CASER A 599 33.624 12.259 67.620 1.00 0.00 ATOM 687 CB SER A 599 33.723 12.174 69.136 1.00 0.00 ATOM 688 OG SER A 599 32.627 12.901 69.675 1.00 0.00 ATOM 689 C SER A 599 32.271 11.690 67.204 1.00 0.00 ATOM 690 O SER A 599 32.081 10.475 67.351 1.00 0.00ATOM 691 N TRP A 600 31.435 12.468 66.531 1.00 0.00 ATOM 693 CA TRP A 600 30.040 12.049 66.305 1.00 0.00 ATOM 694 CB TRP A 600 29.232 13.214 65.714 1.00 0.00 ATOM 695 CG TRP A 600 29.398 13.482 64.224 1.00 0.00 ATOM 696 CD1 TRP A 600 30.539 13.900 63.5741.00 0.00 ATOM 697 NE1 TRP A 600 30.273 14.004 62.250 1.00 0.00 ATOM 699 CE2 TRP A 600 28.996 13.673 61.983 1.00 0.00 ATOM 700 CZ2 TRP A 600 28.262 13.629 60.808 1.00 0.00 ATOM 701 CH2 TRP A 600 26.927 13.240 60.843 1.00 0.00 ATOM 702 CZ3 TRP A 60026.327 12.899 62.052 1.00 0.00 ATOM 703 CE3 TRP A 600 27.054 12.944 63.234 1.00 0.00 ATOM 704 CD2 TRP A 600 28.386 13.332 63.204 1.00 0.00 ATOM 705 C TRP A 600 29.909 10.820 65.402 1.00 0.00 ATOM 706 O TRP A 600 29.151 9.910 65.763 1.00 0.00 ATOM 707 NMET A 601 30.850 10.632 64.487 1.00 0.00 ATOM 709 CA MET A 601 30.744 9.511 63.559 1.00 0.00 ATOM 710 CB MET A 601 31.575 9.809 62.319 1.00 0.00 ATOM 711 CG MET A 601 30.690 9.840 61.079 1.00 0.00 ATOM 712 SD MET A 601 29.759 8.325 60.753 1.00 0.00 ATOM713 CE MET A 601 28.886 8.842 59.258 1.00 0.00 ATOM 714 C MET A 601 31.206 8.206 64.187 1.00 0.00 ATOM 715 O MET A 601 30.581 7.168 63.946 1.00 0.00 ATOM 716 N PHE A 602 32.096 8.276 65.162 1.00 0.00 ATOM 718 CA PHE A 602 32.505 7.022 65.779 1.00 0.00ATOM 719 CB PHE A 602 33.998 6.996 66.065 1.00 0.00 ATOM 720 CG PHE A 602 34.476 5.568 66.316 1.00 0.00 ATOM 721 CD1 PHE A 602 33.801 4.508 65.720 1.00 0.00 ATOM 722 CE1 PHE A 602 34.205 3.202 65.957 1.00 0.00 ATOM 723 CZ PHE A 602 35.293 2.956 66.7801.00 0.00 ATOM 724 CE2 PHE A 602 35.988 4.014 67.350 1.00 0.00 ATOM 725 CD2 PHE A 602 35.583 5.322 67.114 1.00 0.00 ATOM 726 C PHE A 602 31.693 6.751 67.040 1.00 0.00 ATOM 727 O PHE A 602 31.553 5.587 67.425 1.00 0.00 ATOM 728 N LEU A 603 30.974 7.74467.531 1.00 0.00 ATOM 730 CA LEU A 603 30.038 7.458 68.617 1.00 0.00 ATOM 731 CB LEU A 603 29.579 8.757 69.271 1.00 0.00 ATOM 732 CG LEU A 603 30.709 9.450 70.024 1.00 0.00 ATOM 733 CD1 LEU A 603 30.235 10.779 70.601 1.00 0.00 ATOM 734 CD2 LEU A 60331.272 8.559 71.126 1.00 0.00 ATOM 735 C LEU A 603 28.837 6.696 68.069 1.00 0.00 ATOM 736 O LEU A 603 28.516 5.617 68.589 1.00 0.00 ATOM 737 N MET A 604 28.399 7.068 66.876 1.00 0.00 ATOM 739 CA MET A 604 27.269 6.355 66.278 1.00 0.00 ATOM 740 CB MET A604 26.546 7.278 65.295 1.00 0.00 ATOM 741 CG MET A 604 27.430 7.788 64.164 1.00 0.00 ATOM 742 SD MET A 604 26.649 8.960 63.033 1.00 0.00 ATOM 743 CE MET A 604 25.297 7.919 62.439 1.00 0.00 ATOM 744 C MET A 604 27.687 5.039 65.612 1.00 0.00 ATOM 745 OMET A 604 26.922 4.069 65.699 1.00 0.00 ATOM 746 N ALA A 605 28.948 4.916 65.223 1.00 0.00 ATOM 748 CA ALA A 605 29.417 3.659 64.631 1.00 0.00 ATOM 749 CB ALA A 605 30.571 3.954 63.682 1.00 0.00 ATOM 750 C ALA A 605 29.864 2.639 65.675 1.00 0.00 ATOM 751O ALA A 605 29.707 1.434 65.448 1.00 0.00 ATOM 752 N PHE A 606 30.208 3.099 66.867 1.00 0.00 ATOM 754 CA PHE A 606 30.563 2.168 67.938 1.00 0.00 ATOM 755 CB PHE A 606 31.488 2.877 68.920 1.00 0.00 ATOM 756 CG PHE A 606 32.423 1.957 69.697 1.00 0.00 ATOM757 CD1 PHE A 606 32.882 0.782 69.115 1.00 0.00 ATOM 758 CE1 PHE A 606 33.747 -0.048 69.816 1.00 0.00 ATOM 759 CZ PHE A 606 34.155 0.297 71.098 1.00 0.00 ATOM 760 CE2 PHE A 606 33.697 1.472 71.680 1.00 0.00 ATOM 761 CD2 PHE A 606 32.830 2.300 70.980 1.000.00 ATOM 762 C PHE A 606 29.292 1.717 68.645 1.00 0.00 ATOM 763 O PHE A 606 29.201 0.564 69.090 1.00 0.00 ATOM 764 N ALA A 607 28.256 2.536 68.531 1.00 0.00 ATOM 766 CA ALA A 607 26.931 2.134 68.999 1.00 0.00 ATOM 767 CB ALA A 607 26.015 3.353 69.0191.00 0.00 ATOM 768 C ALA A 607 26.358 1.075 68.068 1.00 0.00 ATOM 769 O ALA A 607 25.956 0.011 68.549 1.00 0.00 ATOM 770 N LEU A 608 26.588 1.243 66.774 1.00 0.00 ATOM 772 CA LEU A 608 26.178 0.243 65.778 1.00 0.00 ATOM 773 CB LEU A 608 26.480 0.82564.402 1.00 0.00 ATOM 774 CG LEU A 608 26.293 -0.194 63.284 1.00 0.00 ATOM 775 CD1 LEU A 608 24.846 -0.648 63.180 1.00 0.00 ATOM 776 CD2 LEU A 608 26.758 0.383 61.957 1.00 0.00 ATOM 777 C LEU A 608 26.943 -1.067 65.949 1.00 0.00 ATOM 778 O LEU A 60826.328 -2.141 65.989 1.00 0.00 ATOM 779 N GLY A 609 28.229 -0.952 66.243 1.00 0.00 ATOM 781 CA GLY A 609 29.068 -2.113 66.542 1.00 0.00 ATOM 782 C GLY A 609 28.504 -2.934 67.694 1.00 0.00 ATOM 783 O GLY A 609 28.122 -4.094 67.488 1.00 0.00 ATOM 784 NTRP A 610 28.237 -2.271 68.808 1.00 0.00 ATOM 786 CA TRP A 610 27.778 -2.964 70.012 1.00 0.00 ATOM 787 CB TRP A 610 27.928 -1.998 71.173 1.00 0.00 ATOM 788 CG TRP A 610 27.755 -2.641 72.528 1.00 0.00 ATOM 789 CD1 TRP A 610 26.658 -2.568 73.358 1.00 0.00ATOM 790 NE1 TRP A 610 26.925 -3.278 74.483 1.00 0.00 ATOM 792 CE2 TRP A 610 28.158 -3.820 74.436 1.00 0.00 ATOM 793 CZ2 TRP A 610 28.880 -4.593 75.328 1.00 0.00 ATOM 794 CH2 TRP A 610 30.164 -5.012 74.995 1.00 0.00 ATOM 795 CZ3 TRP A 610 30.726 -4.65673.774 1.00 0.00 ATOM 796 CE3 TRP A 610 30.011 -3.878 72.876 1.00 0.00 ATOM 797 CD2 TRP A 610 28.730 -3.457 73.206 1.00 0.00 ATOM 798 C TRP A 610 26.323 -3.424 69.949 1.00 0.00 ATOM 799 O TRP A 610 26.014 -4.495 70.485 1.00 0.00 ATOM 800 N ARG A 61125.492 -2.762 69.162 1.00 0.00 ATOM 802 CA ARG A 611 24.107 -3.219 69.027 1.00 0.00 ATOM 803 CB ARG A 611 23.235 -2.083 68.512 1.00 0.00 ATOM 804 CG ARG A 611 23.117 -0.950 69.523 1.00 0.00 ATOM 805 CD ARG A 611 22.226 0.158 68.981 1.00 0.00 ATOM 806 NEARG A 611 22.725 0.624 67.678 1.00 0.00 ATOM 807 CZ ARG A 611 22.559 1.868 67.227 1.00 0.00 ATOM 808 NH1 ARG A 611 21.888 2.760 67.961 1.00 0.00 ATOM 809 NH2 ARG A 611 23.050 2.216 66.036 1.00 0.00 ATOM 810 C ARG A 611 24.014 -4.402 68.074 1.00 0.00ATOM 811 O ARG A 611 23.218 -5.317 68.315 1.00 0.00 ATOM 812 N SER A 612 24.963 -4.499 67.159 1.00 0.00 ATOM 814 CA SER A 612 25.031 -5.671 66.291 1.00 0.00 ATOM 815 CB SER A 612 25.949 -5.357 65.123 1.00 0.00 ATOM 816 OG SER A 612 25.359 -4.282 64.4141.00 0.00 ATOM 817 C SER A 612 25.595 -6.845 67.066 1.00 0.00 ATOM 818 O SER A 612 24.998 -7.932 67.061 1.00 0.00 ATOM 819 N TYR A 613 26.556 -6.544 67.924 1.00 0.00 ATOM 821 CA TYR A 613 27.149 -7.554 68.799 1.00 0.00 ATOM 822 CB TYR A 613 28.266 -6.89269.600 1.00 0.00 ATOM 823 CG TYR A 613 29.046 -7.820 70.528 1.00 0.00 ATOM 824 CD1 TYR A 613 29.154 -9.176 70.243 1.00 0.00 ATOM 825 CE1 TYR A 613 29.872 -10.007 71.092 1.00 0.00 ATOM 826 CZ TYR A 613 30.487 -9.480 72.219 1.00 0.00 ATOM 827 OH TYR A 61331.350 -10.262 72.951 1.00 0.00 ATOM 828 CE2 TYR A 613 30.369 -8.129 72.513 1.00 0.00 ATOM 829 CD2 TYR A 613 29.646 -7.300 71.667 1.00 0.00 ATOM 830 C TYR A 613 26.098 -8.149 69.732 1.00 0.00 ATOM 831 O TYR A 613 25.861 -9.360 69.661 1.00 0.00 ATOM 832 NARG A 614 25.301 -7.297 70.352 1.00 0.00 ATOM 834 CA ARG A 614 24.261 -7.779 71.260 1.00 0.00 ATOM 835 CB ARG A 614 23.755 -6.602 72.083 1.00 0.00 ATOM 836 CG ARG A 614 24.793 -6.158 73.104 1.00 0.00 ATOM 837 CD ARG A 614 25.104 -7.292 74.075 1.00 0.00ATOM 838 NE ARG A 614 26.038 -6.865 75.129 1.00 0.00 ATOM 839 CZ ARG A 614 25.667 -6.698 76.401 1.00 0.00 ATOM 840 NH1 ARG A 614 24.396 -6.898 76.758 1.00 0.00 ATOM 841 NH2 ARG A 614 26.563 -6.319 77.315 1.00 0.00 ATOM 842 C ARG A 614 23.083 -8.44570.553 1.00 0.00 ATOM 843 O ARG A 614 22.912 -9.662 70.685 1.00 0.00 ATOM 844 N GLN A 615 22.409 -7.721 69.674 1.00 0.00 ATOM 846 CA GLN A 615 21.115 -8.198 69.168 1.00 0.00 ATOM 847 CB GLN A 615 20.284 -6.973 68.777 1.00 0.00 ATOM 848 CG GLN A 61518.816 -7.326 68.538 1.00 0.00 ATOM 849 CD GLN A 615 17.992 -6.089 68.185 1.00 0.00 ATOM 850 OE1 GLN A 615 18.283 -4.972 68.631 1.00 0.00 ATOM 851 NE2 GLN A 615 16.941 -6.320 67.419 1.00 0.00 ATOM 854 C GLN A 615 21.214 -9.180 67.993 1.00 0.00 ATOM 855 OGLN A 615 20.241 -9.893 67.722 1.00 0.00 ATOM 856 N SER A 616 22.363 -9.283 67.345 1.00 0.00

ATOM 858 CA SER A 616 22.472 -10.273 66.267 1.00 0.00 ATOM 859 CB SER A 616 22.640 -9.570 64.925 1.00 0.00 ATOM 860 OG SER A 616 24.018 -9.260 64.758 1.00 0.00 ATOM 861 C SER A 616 23.648 -11.225 66.457 1.00 0.00 ATOM 862 O SER A 616 23.869-12.079 65.593 1.00 0.00 ATOM 863 N SER A 617 24.401 -11.069 67.537 1.00 0.00 ATOM 865 CA SER A 617 25.662 -11.813 67.737 1.00 0.00 ATOM 866 CB SER A 617 25.405 -13.317 67.801 1.00 0.00 ATOM 867 OG SER A 617 26.636 -13.965 68.091 1.00 0.00 ATOM 868 C SERA 617 26.655 -11.458 66.629 1.00 0.00 ATOM 869 O SER A 617 27.124 -12.313 65.866 1.00 0.00 ATOM 870 N ALA A 618 26.799 -10.151 66.470 1.00 0.00 ATOM 872 CA ALA A 618 27.716 -9.457 65.542 1.00 0.00 ATOM 873 CB ALA A 618 29.126 -9.555 66.103 1.00 0.00 ATOM874 C ALA A 618 27.743 -9.869 64.067 1.00 0.00 ATOM 875 O ALA A 618 28.769 -9.651 63.412 1.00 0.00 ATOM 876 N ASN A 619 26.663 -10.413 63.531 1.00 0.00 ATOM 878 CA ASN A 619 26.655 -10.707 62.098 1.00 0.00 ATOM 879 CB ASN A 619 26.274 -12.171 61.876 1.000.00 ATOM 880 CG ASN A 619 25.046 -12.570 62.689 1.00 0.00 ATOM 881 OD1 ASN A 619 23.958 -12.001 62.539 1.00 0.00 ATOM 882 ND2 ASN A 619 25.238 -13.565 63.536 1.00 0.00 ATOM 885 C ASN A 619 25.759 -9.779 61.276 1.00 0.00 ATOM 886 O ASN A 619 25.995-9.640 60.070 1.00 0.00 ATOM 887 N LEU A 620 24.789 -9.111 61.885 1.00 0.00 ATOM 889 CA LEU A 620 23.941 -8.201 61.109 1.00 0.00 ATOM 890 CB LEU A 620 22.482 -8.648 61.178 1.00 0.00 ATOM 891 CG LEU A 620 22.267 -10.064 60.651 1.00 0.00 ATOM 892 CD1 LEU A620 20.812 -10.490 60.813 1.00 0.00 ATOM 893 CD2 LEU A 620 22.709 -10.203 59.198 1.00 0.00 ATOM 894 C LEU A 620 24.061 -6.803 61.686 1.00 0.00 ATOM 895 O LEU A 620 24.332 -6.640 62.882 1.00 0.00 ATOM 896 N LEU A 621 23.840 -5.806 60.848 1.00 0.00 ATOM898 CA LEU A 621 23.954 -4.420 61.305 1.00 0.00 ATOM 899 CB LEU A 621 24.308 -3.512 60.139 1.00 0.00 ATOM 900 CG LEU A 621 25.760 -3.705 59.726 1.00 0.00 ATOM 901 CD1 LEU A 621 26.101 -2.813 58.543 1.00 0.00 ATOM 902 CD2 LEU A 621 26.699 -3.420 60.8951.00 0.00 ATOM 903 C LEU A 621 22.681 -3.941 61.984 1.00 0.00 ATOM 904 O LEU A 621 21.679 -3.588 61.349 1.00 0.00 ATOM 905 N CYS A 622 22.786 -3.844 63.293 1.00 0.00 ATOM 907 CA CYS A 622 21.660 -3.399 64.108 1.00 0.00 ATOM 908 CB CYS A 622 21.679 -4.10865.452 1.00 0.00 ATOM 909 SG CYS A 622 20.424 -3.549 66.627 1.00 0.00 ATOM 910 C CYS A 622 21.738 -1.900 64.321 1.00 0.00 ATOM 911 O CYS A 622 22.496 -1.408 65.164 1.00 0.00 ATOM 912 N PHE A 623 20.958 -1.181 63.533 1.00 0.00 ATOM 914 CA PHE A 62320.917 0.275 63.655 1.00 0.00 ATOM 915 CB PHE A 623 20.624 0.882 62.287 1.00 0.00 ATOM 916 CG PHE A 623 21.739 0.764 61.252 1.00 0.00 ATOM 917 CD1 PHE A 623 22.768 1.697 61.241 1.00 0.00 ATOM 918 CE1 PHE A 623 23.780 1.604 60.295 1.00 0.00 ATOM 919 CZPHE A 623 23.763 0.580 59.357 1.00 0.00 ATOM 920 CE2 PHE A 623 22.733 -0.350 59.366 1.00 0.00 ATOM 921 CD2 PHE A 623 21.720 -0.257 60.311 1.00 0.00 ATOM 922 C PHE A 623 19.809 0.658 64.622 1.00 0.00 ATOM 923 O PHE A 623 19.852 1.699 65.286 1.00 0.00 ATOM924 N ALA A 624 18.868 -0.256 64.749 1.00 0.00 ATOM 926 CA ALA A 624 17.746 -0.077 65.665 1.00 0.00 ATOM 927 CB ALA A 624 16.787 0.909 65.009 1.00 0.00 ATOM 928 C ALA A 624 17.065 -1.423 65.853 1.00 0.00 ATOM 929 O ALA A 624 17.204 -2.292 64.984 1.000.00 ATOM 930 N PRO A 625 16.223 -1.562 66.867 1.00 0.00 ATOM 931 CA PRO A 625 15.400 -2.777 66.970 1.00 0.00 ATOM 932 CB PRO A 625 14.682 -2.644 68.279 1.00 0.00 ATOM 933 CG PRO A 625 14.985 -1.282 68.887 1.00 0.00 ATOM 934 CD PRO A 625 15.945 -0.59367.932 1.00 0.00 ATOM 935 C PRO A 625 14.407 -2.928 65.803 1.00 0.00 ATOM 936 O PRO A 625 14.127 -4.055 65.379 1.00 0.00 ATOM 937 N ASP A 626 14.030 -1.813 65.189 1.00 0.00 ATOM 939 CA ASP A 626 13.174 -1.813 63.994 1.00 0.00 ATOM 940 CB ASP A 62612.237 -0.598 64.034 1.00 0.00 ATOM 941 CG ASP A 626 12.982 0.736 63.929 1.00 0.00 ATOM 942 OD1 ASP A 626 13.627 1.110 64.901 1.00 0.00 ATOM 943 OD2 ASP A 626 12.763 1.458 62.963 1.00 0.00 ATOM 944 C ASP A 626 13.974 -1.790 62.686 1.00 0.00 ATOM 945 OASP A 626 13.374 -1.775 61.605 1.00 0.00 ATOM 946 N LEU A 627 15.297 -1.811 62.774 1.00 0.00 ATOM 948 CA LEU A 627 16.135 -1.725 61.571 1.00 0.00 ATOM 949 CB LEU A 627 16.541 -0.272 61.354 1.00 0.00 ATOM 950 CG LEU A 627 17.229 -0.082 60.006 1.00 0.00ATOM 951 CD1 LEU A 627 16.321 -0.525 58.863 1.00 0.00 ATOM 952 CD2 LEU A 627 17.659 1.367 59.815 1.00 0.00 ATOM 953 C LEU A 627 17.379 -2.609 61.697 1.00 0.00 ATOM 954 O LEU A 627 18.441 -2.175 62.175 1.00 0.00 ATOM 955 N ILE A 628 17.212 -3.854 61.2821.00 0.00 ATOM 957 CA ILE A 628 18.310 -4.831 61.278 1.00 0.00 ATOM 958 CB ILE A 628 17.836 -6.121 61.943 1.00 0.00 ATOM 959 CG2 ILE A 628 18.979 -7.131 62.016 1.00 0.00 ATOM 960 CG1 ILE A 628 17.292 -5.862 63.342 1.00 0.00 ATOM 961 CD1 ILE A 628 18.399-5.394 64.274 1.00 0.00 ATOM 962 C ILE A 628 18.721 -5.133 59.841 1.00 0.00 ATOM 963 O ILE A 628 18.089 -5.945 59.150 1.00 0.00 ATOM 964 N ILE A 629 19.800 -4.504 59.417 1.00 0.00 ATOM 966 CA ILE A 629 20.255 -4.648 58.035 1.00 0.00 ATOM 967 CB ILE A629 21.033 -3.398 57.642 1.00 0.00 ATOM 968 CG2 ILE A 629 21.708 -3.589 56.288 1.00 0.00 ATOM 969 CG1 ILE A 629 20.113 -2.184 57.608 1.00 0.00 ATOM 970 CD1 ILE A 629 19.048 -2.326 56.527 1.00 0.00 ATOM 971 C ILE A 629 21.113 -5.891 57.843 1.00 0.00 ATOM972 O ILE A 629 22.222 -6.019 58.379 1.00 0.00 ATOM 973 N ASN A 630 20.530 -6.847 57.143 1.00 0.00 ATOM 975 CA ASN A 630 21.286 -8.016 56.703 1.00 0.00 ATOM 976 CB ASN A 630 20.371 -9.236 56.584 1.00 0.00 ATOM 977 CG ASN A 630 19.231 -9.020 55.595 1.000.00 ATOM 978 OD1 ASN A 630 19.454 -8.971 54.379 1.00 0.00 ATOM 979 ND2 ASN A 630 18.016 -9.001 56.117 1.00 0.00 ATOM 982 C ASN A 630 21.984 -7.690 55.387 1.00 0.00 ATOM 983 O ASN A 630 21.666 -6.685 54.735 1.00 0.00 ATOM 984 N GLU A 631 22.800 -8.61854.919 1.00 0.00 ATOM 986 CA GLU A 631 23.664 -8.354 53.757 1.00 0.00 ATOM 987 CB GLU A 631 24.838 -9.345 53.721 1.00 0.00 ATOM 988 CG GLU A 631 24.486 -10.782 53.317 1.00 0.00 ATOM 989 CD GLU A 631 24.159 -11.676 54.514 1.00 0.00 ATOM 990 OE1 GLU A 63125.048 -12.398 54.937 1.00 0.00 ATOM 991 OE2 GLU A 631 23.111 -11.453 55.121 1.00 0.00 ATOM 992 C GLU A 631 22.919 -8.369 52.414 1.00 0.00 ATOM 993 O GLU A 631 23.433 -7.814 51.438 1.00 0.00 ATOM 994 N GLN A 632 21.658 -8.773 52.419 1.00 0.00 ATOM 996CA GLN A 632 20.849 -8.769 51.199 1.00 0.00 ATOM 997 CB GLN A 632 19.841 -9.923 51.219 1.00 0.00 ATOM 998 CG GLN A 632 20.456 -11.308 50.997 1.00 0.00 ATOM 999 CD GLN A 632 20.990 -11.938 52.284 1.00 0.00 ATOM 1000 OE1 GLN A 632 22.124 -12.427 52.3271.00 0.00 ATOM 1001 NE2 GLN A 632 20.203 -11.842 53.342 1.00 0.00 ATOM 1004 C GLN A 632 20.083 -7.455 51.042 1.00 0.00 ATOM 1005 O GLN A 632 19.446 -7.237 50.005 1.00 0.00 ATOM 1006 N ARG A 633 20.146 -6.586 52.041 1.00 0.00 ATOM 1008 CA ARG A 633 19.444-5.304 51.928 1.00 0.00 ATOM 1009 CB ARG A 633 18.962 -4.865 53.303 1.00 0.00 ATOM 1010 CG ARG A 633 18.282 -6.014 54.029 1.00 0.00 ATOM 1011 CD ARG A 633 17.471 -5.518 55.213 1.00 0.00 ATOM 1012 NE ARG A 633 16.273 -4.832 54.715 1.00 0.00 ATOM 1013 CZARG A 633 15.417 -4.165 55.490 1.00 0.00 ATOM 1014 NH1 ARG A 633 15.680 -3.992 56.788 1.00 0.00 ATOM 1015 NH2 ARG A 633 14.332 -3.614 54.946 1.00 0.00 ATOM 1016 C ARG A 633 20.350 -4.223 51.358 1.00 0.00 ATOM 1017 O ARG A 633 19.866 -3.225 50.808 1.000.00 ATOM 1018 N MET A 634 21.649 -4.463 51.388 1.00 0.00 ATOM 1020 CA MET A 634 22.582 -3.481 50.832 1.00 0.00 ATOM 1021 CB MET A 634 23.781 -3.338 51.755 1.00 0.00 ATOM 1022 CG MET A 634 23.365 -2.639 53.042 1.00 0.00 ATOM 1023 SD MET A 634 22.588-1.024 52.799 1.00 0.00 ATOM 1024 CE MET A 634 22.391 -0.515 54.522 1.00 0.00 ATOM 1025 C MET A 634 23.013 -3.864 49.424 1.00 0.00 ATOM 1026 O MET A 634 24.138 -4.318 49.189 1.00 0.00 ATOM 1027 N THR A 635 22.134 -3.554 48.485 1.00 0.00 ATOM 1029 CA THRA 635 22.369 -3.888 47.078 1.00 0.00 ATOM 1030 CB THR A 635 21.008 -4.091 46.411 1.00 0.00 ATOM 1031 OG1 THR A 635 21.211 -4.321 45.024 1.00 0.00 ATOM 1032 CG2 THR A 635 20.096 -2.877 46.566 1.00 0.00 ATOM 1033 C THR A 635 23.194 -2.824 46.345 1.00 0.00ATOM 1034 O THR A 635 23.726 -3.090 45.261 1.00 0.00 ATOM 1035 N LEU A 636 23.365 -1.664 46.958 1.00 0.00 ATOM 1037 CA LEU A 636 24.251 -0.649 46.383 1.00 0.00 ATOM 1038 CB LEU A 636 23.785 0.731 46.860 1.00 0.00 ATOM 1039 CG LEU A 636 24.373 1.89746.057 1.00 0.00 ATOM 1040 CD1 LEU A 636 23.423 3.086 46.029 1.00 0.00 ATOM 1041 CD2 LEU A 636 25.753 2.332 46.541 1.00 0.00 ATOM 1042 C LEU A 636 25.670 -0.967 46.844 1.00 0.00 ATOM 1043 O LEU A 636 25.964 -0.877 48.042 1.00 0.00 ATOM 1044 N PRO A 63726.561 -1.189 45.889 1.00 0.00 ATOM 1045 CA PRO A 637 27.835 -1.858 46.181 1.00 0.00 ATOM 1046 CB PRO A 637 28.485 -2.063 44.846 1.00 0.00 ATOM 1047 CG PRO A 637 27.568 -1.545 43.748 1.00 0.00 ATOM 1048 CD PRO A 637 26.323 -1.032 44.450 1.00 0.00 ATOM1049 C PRO A 637 28.749 -1.069 47.119 1.00 0.00 ATOM 1050 O PRO A 637 29.155 -1.622 48.146 1.00 0.00 ATOM 1051 N CYS A 638 28.778 0.247 46.973 1.00 0.00 ATOM 1053 CA CYS A 638 29.640 1.074 47.829 1.00 0.00 ATOM 1054 CB CYS A 638 29.791 2.441 47.175 1.000.00 ATOM 1055 SG CYS A 638 30.496 2.427 45.511 1.00 0.00 ATOM 1056 C CYS A 638 29.076 1.242 49.241 1.00 0.00 ATOM 1057 O CYS A 638 29.847 1.199 50.209 1.00 0.00 ATOM 1058 N MET A 639 27.769 1.080 49.370 1.00 0.00 ATOM 1060 CA MET A 639 27.129 1.17550.677 1.00 0.00 ATOM 1061 CB MET A 639 25.646 1.457 50.467 1.00 0.00 ATOM 1062 CG MET A 639 24.918 1.641 51.792 1.00 0.00 ATOM 1063 SD MET A 639 25.516 2.998 52.822 1.00 0.00 ATOM 1064 CE MET A 639 24.392 2.809 54.225 1.00 0.00 ATOM 1065 C MET A 63927.313 -0.136 51.428 1.00 0.00 ATOM 1066 O MET A 639 27.702 -0.104 52.601 1.00 0.00 ATOM 1067 N TYR A 640 27.376 -1.226 50.678 1.00 0.00 ATOM 1069 CA TYR A 640 27.632 -2.544 51.264 1.00 0.00 ATOM 1070 CB TYR A 640 27.194 -3.604 50.263 1.00 0.00 ATOM 1071CG TYR A 640 27.344 -5.031 50.776 1.00 0.00 ATOM 1072 CD1 TYR A 640 26.853 -5.370 52.031 1.00 0.00 ATOM 1073 CE1 TYR A 640 26.992 -6.668 52.503 1.00 0.00 ATOM 1074 CZ TYR A 640 27.620 -7.624 51.716 1.00 0.00 ATOM 1075 OH TYR A 640 27.774 -8.907 52.1911.00 0.00 ATOM 1076 CE2 TYR A 640 28.107 -7.290 50.460 1.00 0.00 ATOM 1077 CD2 TYR A 640 27.968 -5.991 49.989 1.00 0.00 ATOM 1078 C TYR A 640 29.114 -2.737 51.587 1.00 0.00 ATOM 1079 O TYR A 640 29.441 -3.369 52.598 1.00 0.00 ATOM 1080 N ASP A 641 29.970-1.993 50.906 1.00 0.00 ATOM 1082 CA ASP A 641 31.403 -2.022 51.212 1.00 0.00 ATOM 1083 CB ASP A 641 32.174 -1.359 50.073 1.00 0.00 ATOM 1084 CG ASP A 641 31.985 -2.107 48.754 1.00 0.00 ATOM 1085 OD1 ASP A 641 31.899 -3.328 48.792 1.00 0.00 ATOM 1086 OD2ASP A 641 32.034 -1.450 47.721 1.00 0.00 ATOM 1087 C ASP A 641 31.680 -1.266 52.507 1.00 0.00 ATOM 1088 O ASP A 641 32.427 -1.759 53.361 1.00 0.00 ATOM 1089 N GLN A 642 30.885 -0.239 52.763 1.00 0.00 ATOM 1091 CA GLN A 642 30.995 0.486 54.028 1.00 0.00ATOM 1092 CB GLN A 642 30.375 1.863 53.850 1.00 0.00 ATOM 1093 CG GLN A 642 30.481 2.664 55.138 1.00 0.00 ATOM 1094 CD GLN A 642 29.900 4.054 54.938 1.00 0.00 ATOM 1095 OE1 GLN A 642 30.613 5.055 55.070 1.00 0.00 ATOM 1096 NE2 GLN A 642 28.615 4.09854.636 1.00 0.00 ATOM 1099 C GLN A 642 30.292 -0.260 55.162 1.00 0.00 ATOM 1100 O GLN A 642 30.757 -0.219 56.308 1.00 0.00 ATOM 1101 N CYS A 643 29.367 -1.135 54.805 1.00 0.00 ATOM 1103 CA CYS A 643 28.738 -2.009 55.795 1.00 0.00 ATOM 1104 CB CYS A 64327.440 -2.559 55.219 1.00 0.00 ATOM 1105 SG CYS A 643 26.127 -1.339 54.997 1.00 0.00 ATOM 1106 C CYS A 643 29.655 -3.156 56.201 1.00 0.00 ATOM 1107 O CYS A 643 29.618 -3.566 57.365 1.00 0.00 ATOM 1108 N LYS A 644 30.634 -3.471 55.367 1.00 0.00 ATOM 1110CA LYS A 644 31.654 -4.447 55.759 1.00 0.00 ATOM 1111 CB LYS A 644 32.305 -5.027 54.507 1.00 0.00 ATOM 1112 CG LYS A 644 31.338 -5.789 53.595 1.00 0.00 ATOM 1113 CD LYS A 644 30.873 -7.138 54.153 1.00 0.00 ATOM 1114 CE LYS A 644 29.694 -7.035 55.121 1.000.00 ATOM 1115 NZ LYS A 644 29.317 -8.358 55.640 1.00 0.00 ATOM 1116 C LYS A 644 32.715 -3.800 56.645 1.00 0.00 ATOM 1117 O LYS A 644 33.216 -4.451 57.568 1.00 0.00 ATOM 1118 N HIS A 645 32.825 -2.484 56.555 1.00 0.00 ATOM 1120 CA HIS A 645 33.718 -1.73857.445 1.00 0.00 ATOM 1121 CB HIS A 645 33.965 -0.352 56.860 1.00 0.00 ATOM 1122 CG HIS A 645 35.017 -0.284 55.773 1.00 0.00 ATOM 1123 ND1 HIS A 645 34.846 -0.527 54.460 1.00 0.00 ATOM 1125 CE1 HIS A 645 36.020 -0.349 53.819 1.00 0.00 ATOM 1126 NE2 HISA 645 36.942 0.002 54.743 1.00 0.00 ATOM 1127 CD2 HIS A 645 36.341 0.042 55.952 1.00 0.00 ATOM 1128 C HIS A 645 33.109 -1.592 58.835 1.00 0.00 ATOM 1129 O HIS A 645 33.808 -1.785 59.837 1.00 0.00 ATOM 1130 N MET A 646 31.790 -1.510 58.889 1.00 0.00 ATOM1132 CA MET A 646 31.101 -1.452 60.182 1.00 0.00 ATOM 1133 CB MET A 646 29.788 -0.706 59.981 1.00 0.00 ATOM 1134 CG MET A 646 30.071 0.699 59.456 1.00 0.00 ATOM 1135 SD MET A 646 28.641 1.774 59.196 1.00 0.00 ATOM 1136 CE MET A 646 27.754 0.800 57.9601.00 0.00 ATOM 1137 C MET A 646 30.871 -2.850 60.763 1.00 0.00 ATOM 1138 O MET A 646 30.815 -3.016 61.990 1.00 0.00 ATOM 1139 N LEU A 647 31.021 -3.852 59.910 1.00 0.00 ATOM 1141 CA LEU A 647 31.002 -5.246 60.351 1.00 0.00 ATOM 1142 CB LEU A 647 30.748-6.136 59.136 1.00 0.00 ATOM 1143 CG LEU A 647 29.661 -7.185 59.372 1.00 0.00 ATOM 1144 CD1 LEU A 647 30.022 -8.157 60.490 1.00 0.00 ATOM 1145 CD2 LEU A 647 28.310 -6.535 59.645 1.00 0.00 ATOM 1146 C LEU A 647 32.347 -5.613 60.976 1.00 0.00

ATOM 1147 O LEU A 647 32.373 -6.428 61.904 1.00 0.00 ATOM 1148 N TYR A 648 33.385 -4.847 60.671 1.00 0.00 ATOM 1150 CA TYR A 648 34.680 -5.063 61.324 1.00 0.00 ATOM 1151 CB TYR A 648 35.785 -4.317 60.579 1.00 0.00 ATOM 1152 CG TYR A 648 36.029-4.744 59.134 1.00 0.00 ATOM 1153 CD1 TYR A 648 36.440 -3.796 58.205 1.00 0.00 ATOM 1154 CE1 TYR A 648 36.659 -4.164 56.884 1.00 0.00 ATOM 1155 CZ TYR A 648 36.475 -5.484 56.499 1.00 0.00 ATOM 1156 OH TYR A 648 36.636 -5.838 55.177 1.00 0.00 ATOM 1157CE2 TYR A 648 36.086 -6.440 57.428 1.00 0.00 ATOM 1158 CD2 TYR A 648 35.868 -6.070 58.749 1.00 0.00 ATOM 1159 C TYR A 648 34.644 -4.554 62.760 1.00 0.00 ATOM 1160 O TYR A 648 35.165 -5.231 63.652 1.00 0.00 ATOM 1161 N VAL A 649 33.814 -3.556 63.019 1.000.00 ATOM 1163 CA VAL A 649 33.677 -3.041 64.383 1.00 0.00 ATOM 1164 CB VAL A 649 32.892 -1.733 64.329 1.00 0.00 ATOM 1165 CG1 VAL A 649 32.756 -1.115 65.717 1.00 0.00 ATOM 1166 CG2 VAL A 649 33.541 -0.745 63.366 1.00 0.00 ATOM 1167 C VAL A 649 32.930-4.047 65.254 1.00 0.00 ATOM 1168 O VAL A 649 33.470 -4.481 66.282 1.00 0.00 ATOM 1169 N SER A 650 31.895 -4.640 64.676 1.00 0.00 ATOM 1171 CA SER A 650 31.086 -5.614 65.412 1.00 0.00 ATOM 1172 CB SER A 650 29.793 -5.857 64.640 1.00 0.00 ATOM 1173 OGSER A 650 29.095 -4.622 64.547 1.00 0.00 ATOM 1174 C SER A 650 31.823 -6.938 65.594 1.00 0.00 ATOM 1175 O SER A 650 31.846 -7.458 66.716 1.00 0.00 ATOM 1176 N SER A 651 32.650 -7.298 64.625 1.00 0.00 ATOM 1178 CA SER A 651 33.413 -8.544 64.722 1.00 0.00ATOM 1179 CB SER A 651 33.898 -8.952 63.334 1.00 0.00 ATOM 1180 OG SER A 651 34.821 -7.972 62.876 1.00 0.00 ATOM 1181 C SER A 651 34.616 -8.432 65.654 1.00 0.00 ATOM 1182 O SER A 651 34.940 -9.426 66.312 1.00 0.00 ATOM 1183 N GLU A 652 35.105 -7.22965.915 1.00 0.00 ATOM 1185 CA GLU A 652 36.214 -7.121 66.865 1.00 0.00 ATOM 1186 CB GLU A 652 37.029 -5.854 66.628 1.00 0.00 ATOM 1187 CG GLU A 652 37.621 -5.783 65.223 1.00 0.00 ATOM 1188 CD GLU A 652 38.337 -7.074 64.835 1.00 0.00 ATOM 1189 OE1 GLU A652 39.488 -7.223 65.220 1.00 0.00 ATOM 1190 OE2 GLU A 652 37.768 -7.812 64.039 1.00 0.00 ATOM 1191 C GLU A 652 35.681 -7.130 68.289 1.00 0.00 ATOM 1192 O GLU A 652 36.244 -7.836 69.133 1.00 0.00 ATOM 1193 N LEU A 653 34.457 -6.653 68.455 1.00 0.00 ATOM1195 CA LEU A 653 33.820 -6.700 69.773 1.00 0.00 ATOM 1196 CB LEU A 653 32.614 -5.767 69.769 1.00 0.00 ATOM 1197 CG LEU A 653 33.009 -4.322 69.486 1.00 0.00 ATOM 1198 CD1 LEU A 653 31.778 -3.450 69.281 1.00 0.00 ATOM 1199 CD2 LEU A 653 33.893 -3.75470.591 1.00 0.00 ATOM 1200 C LEU A 653 33.358 -8.119 70.093 1.00 0.00 ATOM 1201 O LEU A 653 33.492 -8.571 71.239 1.00 0.00 ATOM 1202 N HIS A 654 33.064 -8.866 69.042 1.00 0.00 ATOM 1204 CA HIS A 654 32.661 -10.264 69.169 1.00 0.00 ATOM 1205 CB HIS A 65432.058 -10.685 67.835 1.00 0.00 ATOM 1206 CG HIS A 654 31.437 -12.066 67.819 1.00 0.00 ATOM 1207 ND1 HIS A 654 32.011 -13.208 67.394 1.00 0.00 ATOM 1209 CE1 HIS A 654 31.136 -14.224 67.531 1.00 0.00 ATOM 1210 NE2 HIS A 654 29.994 -13.716 68.046 1.00 0.00ATOM 1211 CD2 HIS A 654 30.163 -12.386 68.227 1.00 0.00 ATOM 1212 C HIS A 654 33.837 -11.173 69.496 1.00 0.00 ATOM 1213 O HIS A 654 33.816 -11.838 70.538 1.00 0.00 ATOM 1214 N ARG A 655 34.924 -11.030 68.754 1.00 0.00 ATOM 1216 CA ARG A 655 36.068-11.938 68.910 1.00 0.00 ATOM 1217 CB ARG A 655 36.914 -11.868 67.647 1.00 0.00 ATOM 1218 CG ARG A 655 36.146 -12.351 66.425 1.00 0.00 ATOM 1219 CD ARG A 655 37.008 -12.253 65.172 1.00 0.00 ATOM 1220 NE ARG A 655 38.220 -13.079 65.312 1.00 0.00 ATOM 1221CZ ARG A 655 39.459 -12.590 65.223 1.00 0.00 ATOM 1222 NH1 ARG A 655 39.649 -11.286 65.012 1.00 0.00 ATOM 1223 NH2 ARG A 655 40.509 -13.403 65.365 1.00 0.00 ATOM 1224 C ARG A 655 36.955 -11.605 70.105 1.00 0.00 ATOM 1225 O ARG A 655 37.716 -12.46470.563 1.00 0.00 ATOM 1226 N LEU A 656 36.832 -10.398 70.628 1.00 0.00 ATOM 1228 CA LEU A 656 37.541 -10.057 71.861 1.00 0.00 ATOM 1229 CB LEU A 656 38.003 -8.609 71.766 1.00 0.00 ATOM 1230 CG LEU A 656 38.995 -8.397 70.626 1.00 0.00 ATOM 1231 CD1 LEU A656 39.336 -6.918 70.473 1.00 0.00 ATOM 1232 CD2 LEU A 656 40.259 -9.226 70.826 1.00 0.00 ATOM 1233 C LEU A 656 36.642 -10.241 73.084 1.00 0.00 ATOM 1234 O LEU A 656 37.136 -10.227 74.220 1.00 0.00 ATOM 1235 N GLN A 657 35.374 -10.533 72.827 1.00 0.00ATOM 1237 CA GLN A 657 34.333 -10.652 73.855 1.00 0.00 ATOM 1238 CB GLN A 657 34.489 -11.972 74.598 1.00 0.00 ATOM 1239 CG GLN A 657 34.336 -13.153 73.649 1.00 0.00 ATOM 1240 CD GLN A 657 34.338 -14.447 74.451 1.00 0.00 ATOM 1241 OE1 GLN A 657 34.424-15.547 73.892 1.00 0.00 ATOM 1242 NE2 GLN A 657 34.208 -14.295 75.758 1.00 0.00 ATOM 1245 C GLN A 657 34.383 -9.490 74.831 1.00 0.00 ATOM 1246 O GLN A 657 34.536 -9.690 76.041 1.00 0.00 ATOM 1247 N VAL A 658 34.190 -8.295 74.298 1.00 0.00 ATOM 1249 CAVAL A 658 34.338 -7.073 75.095 1.00 0.00 ATOM 1250 CB VAL A 658 34.309 -5.890 74.127 1.00 0.00 ATOM 1251 CG1 VAL A 658 34.573 -4.560 74.828 1.00 0.00 ATOM 1252 CG2 VAL A 658 35.324 -6.094 73.011 1.00 0.00 ATOM 1253 C VAL A 658 33.219 -6.953 76.125 1.000.00 ATOM 1254 O VAL A 658 32.049 -7.210 75.818 1.00 0.00 ATOM 1255 N SER A 659 33.592 -6.660 77.360 1.00 0.00 ATOM 1257 CA SER A 659 32.586 -6.398 78.394 1.00 0.00 ATOM 1258 CB SER A 659 33.231 -6.381 79.775 1.00 0.00 ATOM 1259 OG SER A 659 33.860-5.116 79.950 1.00 0.00 ATOM 1260 C SER A 659 31.954 -5.036 78.149 1.00 0.00 ATOM 1261 O SER A 659 32.594 -4.138 77.585 1.00 0.00 ATOM 1262 N TYR A 660 30.798 -4.820 78.754 1.00 0.00 ATOM 1264 CA TYR A 660 30.094 -3.536 78.604 1.00 0.00 ATOM 1265 CB TYRA 660 28.631 -3.697 79.031 1.00 0.00 ATOM 1266 CG TYR A 660 28.387 -4.075 80.495 1.00 0.00 ATOM 1267 CD1 TYR A 660 28.328 -5.412 80.874 1.00 0.00 ATOM 1268 CE1 TYR A 660 28.124 -5.750 82.205 1.00 0.00 ATOM 1269 CZ TYR A 660 27.962 -4.749 83.154 1.00 0.00ATOM 1270 OH TYR A 660 27.954 -5.075 84.492 1.00 0.00 ATOM 1271 CE2 TYR A 660 27.981 -3.414 82.774 1.00 0.00 ATOM 1272 CD2 TYR A 660 28.186 -3.078 81.443 1.00 0.00 ATOM 1273 C TYR A 660 30.769 -2.427 79.414 1.00 0.00 ATOM 1274 O TYR A 660 30.727 -1.25879.014 1.00 0.00 ATOM 1275 N GLU A 661 31.580 -2.821 80.382 1.00 0.00 ATOM 1277 CA GLU A 661 32.356 -1.863 81.164 1.00 0.00 ATOM 1278 CB GLU A 661 32.890 -2.538 82.428 1.00 0.00 ATOM 1279 CG GLU A 661 31.786 -2.930 83.412 1.00 0.00 ATOM 1280 CD GLU A661 31.495 -4.430 83.375 1.00 0.00 ATOM 1281 OE1 GLU A 661 31.605 -5.001 82.294 1.00 0.00 ATOM 1282 OE2 GLU A 661 31.047 -4.947 84.388 1.00 0.00 ATOM 1283 C GLU A 661 33.516 -1.338 80.328 1.00 0.00 ATOM 1284 O GLU A 661 33.669 -0.116 80.202 1.00 0.00ATOM 1285 N GLU A 662 34.168 -2.226 79.589 1.00 0.00 ATOM 1287 CA GLU A 662 35.237 -1.783 78.694 1.00 0.00 ATOM 1288 CB GLU A 662 35.978 -3.010 78.183 1.00 0.00 ATOM 1289 CG GLU A 662 36.714 -3.716 79.313 1.00 0.00 ATOM 1290 CD GLU A 662 37.161 -5.09578.849 1.00 0.00 ATOM 1291 OE1 GLU A 662 36.307 -5.800 78.324 1.00 0.00 ATOM 1292 OE2 GLU A 662 38.346 -5.380 78.933 1.00 0.00 ATOM 1293 C GLU A 662 34.684 -0.993 77.516 1.00 0.00 ATOM 1294 O GLU A 662 35.196 0.101 77.254 1.00 0.00 ATOM 1295 N TYR A 66333.509 -1.369 77.035 1.00 0.00 ATOM 1297 CA TYR A 663 32.888 -0.642 75.925 1.00 0.00 ATOM 1298 CB TYR A 663 31.658 -1.414 75.460 1.00 0.00 ATOM 1299 CG TYR A 663 30.799 -0.633 74.468 1.00 0.00 ATOM 1300 CD1 TYR A 663 31.220 -0.482 73.154 1.00 0.00 ATOM1301 CE1 TYR A 663 30.448 0.246 72.259 1.00 0.00 ATOM 1302 CZ TYR A 663 29.258 0.822 72.680 1.00 0.00 ATOM 1303 OH TYR A 663 28.502 1.554 71.793 1.00 0.00 ATOM 1304 CE2 TYR A 663 28.828 0.664 73.990 1.00 0.00 ATOM 1305 CD2 TYR A 663 29.599 -0.067 74.8831.00 0.00 ATOM 1306 C TYR A 663 32.464 0.772 76.312 1.00 0.00 ATOM 1307 O TYR A 663 32.767 1.712 75.568 1.00 0.00 ATOM 1308 N LEU A 664 32.006 0.957 77.539 1.00 0.00 ATOM 1310 CA LEU A 664 31.543 2.281 77.966 1.00 0.00 ATOM 1311 CB LEU A 664 30.705 2.12579.234 1.00 0.00 ATOM 1312 CG LEU A 664 29.195 2.219 78.995 1.00 0.00 ATOM 1313 CD1 LEU A 664 28.682 1.260 77.927 1.00 0.00 ATOM 1314 CD2 LEU A 664 28.439 1.986 80.294 1.00 0.00 ATOM 1315 C LEU A 664 32.712 3.222 78.235 1.00 0.00 ATOM 1316 O LEU A 66432.674 4.380 77.794 1.00 0.00 ATOM 1317 N CYS A 665 33.828 2.665 78.677 1.00 0.00 ATOM 1319 CA CYS A 665 35.008 3.493 78.920 1.00 0.00 ATOM 1320 CB CYS A 665 35.919 2.760 79.890 1.00 0.00 ATOM 1321 SG CYS A 665 35.186 2.404 81.503 1.00 0.00 ATOM 1322 CCYS A 665 35.751 3.812 77.623 1.00 0.00 ATOM 1323 O CYS A 665 36.166 4.962 77.434 1.00 0.00 ATOM 1324 N MET A 666 35.649 2.927 76.644 1.00 0.00 ATOM 1326 CA MET A 666 36.238 3.199 75.329 1.00 0.00 ATOM 1327 CB MET A 666 36.305 1.897 74.543 1.00 0.00 ATOM1328 CG MET A 666 37.277 0.904 75.160 1.00 0.00 ATOM 1329 SD MET A 666 37.151 -0.776 74.512 1.00 0.00 ATOM 1330 CE MET A 666 37.494 -0.446 72.770 1.00 0.00 ATOM 1331 C MET A 666 35.396 4.188 74.536 1.00 0.00 ATOM 1332 O MET A 666 35.958 5.085 73.9021.00 0.00 ATOM 1333 N LYS A 667 34.097 4.188 74.779 1.00 0.00 ATOM 1335 CA LYS A 667 33.199 5.094 74.067 1.00 0.00 ATOM 1336 CB LYS A 667 31.787 4.547 74.215 1.00 0.00 ATOM 1337 CG LYS A 667 30.755 5.383 73.466 1.00 0.00 ATOM 1338 CD LYS A 667 29.3234.883 73.671 1.00 0.00 ATOM 1339 CE LYS A 667 28.649 5.412 74.942 1.00 0.00 ATOM 1340 NZ LYS A 667 29.218 4.876 76.192 1.00 0.00 ATOM 1341 C LYS A 667 33.283 6.519 74.609 1.00 0.00 ATOM 1342 O LYS A 667 33.311 7.464 73.811 1.00 0.00 ATOM 1343 N THR A 66833.599 6.665 75.888 1.00 0.00 ATOM 1345 CA THR A 668 33.818 8.020 76.403 1.00 0.00 ATOM 1346 CB THR A 668 33.497 8.105 77.895 1.00 0.00 ATOM 1347 OG1 THR A 668 33.777 9.433 78.313 1.00 0.00 ATOM 1348 CG2 THR A 668 34.321 7.157 78.755 1.00 0.00 ATOM 1349C THR A 668 35.238 8.501 76.095 1.00 0.00 ATOM 1350 O THR A 668 35.429 9.701 75.866 1.00 0.00 ATOM 1351 N LEU A 669 36.125 7.567 75.784 1.00 0.00 ATOM 1353 CA LEU A 669 37.451 7.923 75.277 1.00 0.00 ATOM 1354 CB LEU A 669 38.407 6.756 75.489 1.00 0.00ATOM 1355 CG LEU A 669 38.838 6.653 76.945 1.00 0.00 ATOM 1356 CD1 LEU A 669 39.642 5.381 77.188 1.00 0.00 ATOM 1357 CD2 LEU A 669 39.635 7.888 77.348 1.00 0.00 ATOM 1358 C LEU A 669 37.419 8.286 73.796 1.00 0.00 ATOM 1359 O LEU A 669 38.247 9.09873.378 1.00 0.00 ATOM 1360 N LEU A 670 36.348 7.935 73.096 1.00 0.00 ATOM 1362 CA LEU A 670 36.198 8.327 71.687 1.00 0.00 ATOM 1363 CB LEU A 670 35.195 7.409 71.015 1.00 0.00 ATOM 1364 CG LEU A 670 35.713 5.986 71.005 1.00 0.00 ATOM 1365 CD1 LEU A 67034.660 5.048 70.441 1.00 0.00 ATOM 1366 CD2 LEU A 670 37.025 5.893 70.234 1.00 0.00 ATOM 1367 C LEU A 670 35.704 9.756 71.560 1.00 0.00 ATOM 1368 O LEU A 670 36.144 10.482 70.659 1.00 0.00 ATOM 1369 N LEU A 671 35.085 10.230 72.629 1.00 0.00 ATOM 1371 CALEU A 671 34.688 11.635 72.724 1.00 0.00 ATOM 1372 CB LEU A 671 33.669 11.721 73.857 1.00 0.00 ATOM 1373 CG LEU A 671 33.128 13.127 74.083 1.00 0.00 ATOM 1374 CD1 LEU A 671 32.411 13.648 72.844 1.00 0.00 ATOM 1375 CD2 LEU A 671 32.189 13.138 75.283 1.000.00 ATOM 1376 C LEU A 671 35.912 12.500 73.040 1.00 0.00 ATOM 1377 O LEU A 671 35.968 13.679 72.676 1.00 0.00 ATOM 1378 N LEU A 672 36.949 11.845 73.534 1.00 0.00 ATOM 1380 CA LEU A 672 38.228 12.482 73.844 1.00 0.00 ATOM 1381 CB LEU A 672 38.642 11.99375.228 1.00 0.00 ATOM 1382 CG LEU A 672 37.539 12.238 76.254 1.00 0.00 ATOM 1383 CD1 LEU A 672 37.761 11.428 77.524 1.00 0.00 ATOM 1384 CD2 LEU A 672 37.371 13.720 76.568 1.00 0.00 ATOM 1385 C LEU A 672 39.321 12.121 72.826 1.00 0.00 ATOM 1386 O LEU A672 40.502 12.367 73.092 1.00 0.00 ATOM 1387 N SER A 673 38.950 11.557 71.684 1.00 0.00 ATOM 1389 CA SER A 673 39.957 11.067 70.725 1.00 0.00 ATOM 1390 CB SER A 673 39.403 9.861 69.974 1.00 0.00 ATOM 1391 OG SER A 673 39.316 8.768 70.872 1.00 0.00 ATOM1392 C SER A 673 40.419 12.074 69.675 1.00 0.00 ATOM 1393 O SER A 673 41.293 11.728 68.869 1.00 0.00 ATOM 1394 N SER A 674 39.854 13.269 69.632 1.00 0.00 ATOM 1396 CA SER A 674 40.263 14.210 68.577 1.00 0.00 ATOM 1397 CB SER A 674 39.311 14.072 67.3941.00 0.00 ATOM 1398 OG SER A 674 39.394 12.744 66.897 1.00 0.00 ATOM 1399 C SER A 674 40.258 15.664 69.030 1.00 0.00 ATOM 1400 O SER A 674 39.212 16.210 69.399 1.00 0.00 ATOM 1401 N VAL A 675 41.422 16.286 68.964 1.00 0.00 ATOM 1403 CA VAL A 675 41.52217.728 69.218 1.00 0.00 ATOM 1404 CB VAL A 675 42.703 17.996 70.152 1.00 0.00 ATOM 1405 CG1 VAL A 675 42.400 17.553 71.576 1.00 0.00 ATOM 1406 CG2 VAL A 675 43.990 17.360 69.644 1.00 0.00 ATOM 1407 C VAL A 675 41.698 18.466 67.892 1.00 0.00 ATOM 1408 OVAL A 675 41.985 17.835 66.870 1.00 0.00 ATOM 1409 N PRO A 676 41.413 19.756 67.863 1.00 0.00 ATOM 1410 CA PRO A 676 41.889 20.576 66.750 1.00 0.00 ATOM 1411 CB PRO A 676 41.325 21.942 66.995 1.00 0.00 ATOM 1412 CG PRO A 676 40.664 21.967 68.366 1.000.00 ATOM 1413 CD PRO A 676 40.797 20.558 68.922 1.00 0.00 ATOM 1414 C PRO A 676 43.411 20.598 66.756 1.00 0.00 ATOM 1415 O PRO A 676 44.029 20.390 67.807 1.00 0.00 ATOM 1416 N LYS A 677 44.010 20.965 65.635 1.00 0.00 ATOM 1418 CA LYS A 677 45.478 21.03565.565 1.00 0.00 ATOM 1419 CB LYS A 677 45.874 21.122 64.094 1.00 0.00 ATOM 1420 CG LYS A 677 47.359 20.847 63.896 1.00 0.00 ATOM 1421 CD LYS A 677 47.714 19.452 64.398 1.00 0.00 ATOM 1422 CE LYS A 677 49.199 19.161 64.234 1.00 0.00 ATOM 1423 NZ LYS A677 49.523 17.811 64.721 1.00 0.00 ATOM 1424 C LYS A 677 46.051 22.238 66.336 1.00 0.00 ATOM 1425 O LYS A 677 47.238 22.253 66.680 1.00 0.00 ATOM 1426 N ASP A 678 45.185 23.159 66.730 1.00 0.00 ATOM 1428 CA ASP A 678 45.584 24.288 67.577 1.00 0.00 ATOM1429 CB ASP A 678 44.738 25.503 67.209 1.00 0.00 ATOM 1430 CG ASP A 678 44.931 25.879 65.742 1.00 0.00

ATOM 1431 OD1 ASP A 678 44.166 25.385 64.922 1.00 0.00 ATOM 1432 OD2 ASP A 678 45.846 26.640 65.465 1.00 0.00 ATOM 1433 C ASP A 678 45.381 23.999 69.069 1.00 0.00 ATOM 1434 O ASP A 678 45.724 24.842 69.905 1.00 0.00 ATOM 1435 N GLY A 679 44.82922.840 69.400 1.00 0.00 ATOM 1437 CA GLY A 679 44.537 22.520 70.801 1.00 0.00 ATOM 1438 C GLY A 679 43.230 23.158 71.271 1.00 0.00 ATOM 1439 O GLY A 679 42.640 24.000 70.582 1.00 0.00 ATOM 1440 N LEU A 680 42.752 22.677 72.406 1.00 0.00 ATOM 1442 CA LEUA 680 41.547 23.224 73.039 1.00 0.00 ATOM 1443 CB LEU A 680 40.853 22.116 73.820 1.00 0.00 ATOM 1444 CG LEU A 680 40.336 21.013 72.907 1.00 0.00 ATOM 1445 CD1 LEU A 680 39.795 19.854 73.729 1.00 0.00 ATOM 1446 CD2 LEU A 680 39.263 21.541 71.961 1.00 0.00ATOM 1447 C LEU A 680 41.896 24.355 73.999 1.00 0.00 ATOM 1448 O LEU A 680 43.008 24.412 74.539 1.00 0.00 ATOM 1449 N LYS A 681 40.907 25.182 74.296 1.00 0.00 ATOM 1451 CA LYS A 681 41.126 26.285 75.241 1.00 0.00 ATOM 1452 CB LYS A 681 39.953 27.25375.161 1.00 0.00 ATOM 1453 CG LYS A 681 40.145 28.427 76.116 1.00 0.00 ATOM 1454 CD LYS A 681 39.004 29.427 75.994 1.00 0.00 ATOM 1455 CE LYS A 681 39.141 30.567 76.995 1.00 0.00 ATOM 1456 NZ LYS A 681 38.007 31.499 76.875 1.00 0.00 ATOM 1457 C LYS A681 41.271 25.748 76.663 1.00 0.00 ATOM 1458 O LYS A 681 42.271 26.031 77.333 1.00 0.00 ATOM 1459 N SER A 682 40.419 24.800 77.017 1.00 0.00 ATOM 1461 CA SER A 682 40.578 24.096 78.295 1.00 0.00 ATOM 1462 CB SER A 682 39.226 23.905 78.985 1.00 0.00 ATOM1463 OG SER A 682 38.369 23.114 78.171 1.00 0.00 ATOM 1464 C SER A 682 41.279 22.758 78.070 1.00 0.00 ATOM 1465 O SER A 682 40.849 21.718 78.590 1.00 0.00 ATOM 1466 N GLN A 683 42.462 22.836 77.476 1.00 0.00 ATOM 1468 CA GLN A 683 43.238 21.646 77.1071.00 0.00 ATOM 1469 CB GLN A 683 44.399 22.101 76.227 1.00 0.00 ATOM 1470 CG GLN A 683 45.280 20.941 75.774 1.00 0.00 ATOM 1471 CD GLN A 683 44.511 20.017 74.835 1.00 0.00 ATOM 1472 OE1 GLN A 683 43.908 20.471 73.854 1.00 0.00 ATOM 1473 NE2 GLN A 68344.543 18.734 75.143 1.00 0.00 ATOM 1476 C GLN A 683 43.800 20.911 78.320 1.00 0.00 ATOM 1477 O GLN A 683 43.781 19.675 78.332 1.00 0.00 ATOM 1478 N GLU A 684 43.994 21.625 79.418 1.00 0.00 ATOM 1480 CA GLU A 684 44.466 20.976 80.645 1.00 0.00 ATOM 1481CB GLU A 684 44.894 22.049 81.636 1.00 0.00 ATOM 1482 CG GLU A 684 45.348 21.434 82.957 1.00 0.00 ATOM 1483 CD GLU A 684 45.646 22.541 83.962 1.00 0.00 ATOM 1484 OE1 GLU A 684 45.187 23.649 83.718 1.00 0.00 ATOM 1485 OE2 GLU A 684 46.415 22.292 84.8791.00 0.00 ATOM 1486 C GLU A 684 43.365 20.129 81.277 1.00 0.00 ATOM 1487 O GLU A 684 43.616 18.957 81.592 1.00 0.00 ATOM 1488 N LEU A 685 42.130 20.576 81.116 1.00 0.00 ATOM 1490 CA LEU A 685 40.990 19.852 81.678 1.00 0.00 ATOM 1491 CB LEU A 685 39.77820.773 81.840 1.00 0.00 ATOM 1492 CG LEU A 685 39.888 21.764 83.001 1.00 0.00 ATOM 1493 CD1 LEU A 685 40.555 23.076 82.590 1.00 0.00 ATOM 1494 CD2 LEU A 685 38.498 22.074 83.546 1.00 0.00 ATOM 1495 C LEU A 685 40.624 18.688 80.771 1.00 0.00 ATOM 1496 OLEU A 685 40.301 17.605 81.275 1.00 0.00 ATOM 1497 N PHE A 686 40.980 18.815 79.503 1.00 0.00 ATOM 1499 CA PHE A 686 40.797 17.720 78.552 1.00 0.00 ATOM 1500 CB PHE A 686 40.929 18.281 77.144 1.00 0.00 ATOM 1501 CG PHE A 686 40.810 17.222 76.056 1.000.00 ATOM 1502 CD1 PHE A 686 39.556 16.827 75.612 1.00 0.00 ATOM 1503 CE1 PHE A 686 39.448 15.864 74.617 1.00 0.00 ATOM 1504 CZ PHE A 686 40.590 15.293 74.075 1.00 0.00 ATOM 1505 CE2 PHE A 686 41.842 15.681 74.528 1.00 0.00 ATOM 1506 CD2 PHE A 686 41.95116.644 75.518 1.00 0.00 ATOM 1507 C PHE A 686 41.834 16.622 78.764 1.00 0.00 ATOM 1508 O PHE A 686 41.484 15.435 78.734 1.00 0.00 ATOM 1509 N ASP A 687 43.009 17.009 79.235 1.00 0.00 ATOM 1511 CA ASP A 687 44.052 16.032 79.554 1.00 0.00 ATOM 1512 CB ASPA 687 45.367 16.760 79.832 1.00 0.00 ATOM 1513 CG ASP A 687 45.820 17.617 78.652 1.00 0.00 ATOM 1514 OD1 ASP A 687 45.576 17.223 77.517 1.00 0.00 ATOM 1515 OD2 ASP A 687 46.465 18.627 78.900 1.00 0.00 ATOM 1516 C ASP A 687 43.666 15.261 80.809 1.00 0.00ATOM 1517 O ASP A 687 43.729 14.025 80.821 1.00 0.00 ATOM 1518 N GLU A 688 43.004 15.955 81.719 1.00 0.00 ATOM 1520 CA GLU A 688 42.563 15.337 82.968 1.00 0.00 ATOM 1521 CB GLU A 688 42.176 16.455 83.929 1.00 0.00 ATOM 1522 CG GLU A 688 43.381 17.32984.258 1.00 0.00 ATOM 1523 CD GLU A 688 42.945 18.576 85.021 1.00 0.00 ATOM 1524 OE1 GLU A 688 42.967 19.647 84.424 1.00 0.00 ATOM 1525 OE2 GLU A 688 42.663 18.453 86.203 1.00 0.00 ATOM 1526 C GLU A 688 41.374 14.400 82.764 1.00 0.00 ATOM 1527 O GLU A688 41.423 13.265 83.256 1.00 0.00 ATOM 1528 N ILE A 689 40.464 14.748 81.867 1.00 0.00 ATOM 1530 CA ILE A 689 39.301 13.881 81.659 1.00 0.00 ATOM 1531 CB ILE A 689 38.126 14.675 81.078 1.00 0.00 ATOM 1532 CG2 ILE A 689 38.474 15.414 79.794 1.00 0.00ATOM 1533 CG1 ILE A 689 36.936 13.762 80.833 1.00 0.00 ATOM 1534 CD1 ILE A 689 35.876 14.443 79.978 1.00 0.00 ATOM 1535 C ILE A 689 39.631 12.667 80.789 1.00 0.00 ATOM 1536 O ILE A 689 39.161 11.566 81.112 1.00 0.00 ATOM 1537 N ARG A 690 40.623 12.77079.917 1.00 0.00 ATOM 1539 CA ARG A 690 40.971 11.579 79.148 1.00 0.00 ATOM 1540 CB ARG A 690 41.551 11.949 77.783 1.00 0.00 ATOM 1541 CG ARG A 690 42.895 12.665 77.836 1.00 0.00 ATOM 1542 CD ARG A 690 43.397 12.919 76.422 1.00 0.00 ATOM 1543 NE ARG A690 43.374 11.661 75.656 1.00 0.00 ATOM 1544 CZ ARG A 690 44.370 11.256 74.865 1.00 0.00 ATOM 1545 NH1 ARG A 690 45.445 12.029 74.694 1.00 0.00 ATOM 1546 NH2 ARG A 690 44.276 10.090 74.220 1.00 0.00 ATOM 1547 C ARG A 690 41.909 10.679 79.944 1.00 0.00ATOM 1548 O ARG A 690 41.750 9.456 79.873 1.00 0.00 ATOM 1549 N MET A 691 42.589 11.250 80.927 1.00 0.00 ATOM 1551 CA MET A 691 43.444 10.447 81.793 1.00 0.00 ATOM 1552 CB MET A 691 44.382 11.378 82.550 1.00 0.00 ATOM 1553 CG MET A 691 45.336 10.60483.450 1.00 0.00 ATOM 1554 SD MET A 691 46.473 11.625 84.412 1.00 0.00 ATOM 1555 CE MET A 691 47.263 12.517 83.052 1.00 0.00 ATOM 1556 C MET A 691 42.608 9.650 82.784 1.00 0.00 ATOM 1557 O MET A 691 42.790 8.429 82.870 1.00 0.00 ATOM 1558 N THR A 69241.532 10.242 83.281 1.00 0.00 ATOM 1560 CA THR A 692 40.697 9.504 84.231 1.00 0.00 ATOM 1561 CB THR A 692 39.910 10.464 85.122 1.00 0.00 ATOM 1562 OG1 THR A 692 39.130 9.675 86.010 1.00 0.00 ATOM 1563 CG2 THR A 692 38.960 11.372 84.350 1.00 0.00 ATOM1564 C THR A 692 39.759 8.512 83.544 1.00 0.00 ATOM 1565 O THR A 692 39.461 7.473 84.142 1.00 0.00 ATOM 1566 N TYR A 693 39.505 8.671 82.254 1.00 0.00 ATOM 1568 CA TYR A 693 38.719 7.647 81.564 1.00 0.00 ATOM 1569 CB TYR A 693 37.835 8.284 80.503 1.000.00 ATOM 1570 CG TYR A 693 36.652 9.014 81.130 1.00 0.00 ATOM 1571 CD1 TYR A 693 36.047 8.482 82.262 1.00 0.00 ATOM 1572 CE1 TYR A 693 34.978 9.139 82.855 1.00 0.00 ATOM 1573 CZ TYR A 693 34.511 10.325 82.309 1.00 0.00 ATOM 1574 OH TYR A 693 33.53111.038 82.965 1.00 0.00 ATOM 1575 CE2 TYR A 693 35.096 10.847 81.164 1.00 0.00 ATOM 1576 CD2 TYR A 693 36.167 10.189 80.572 1.00 0.00 ATOM 1577 C TYR A 693 39.602 6.536 81.004 1.00 0.00 ATOM 1578 O TYR A 693 39.139 5.395 80.894 1.00 0.00 ATOM 1579 N ILEA 694 40.900 6.789 80.936 1.00 0.00 ATOM 1581 CA ILE A 694 41.857 5.715 80.653 1.00 0.00 ATOM 1582 CB ILE A 694 43.156 6.329 80.133 1.00 0.00 ATOM 1583 CG2 ILE A 694 44.301 5.323 80.167 1.00 0.00 ATOM 1584 CG1 ILE A 694 42.973 6.874 78.722 1.00 0.00 ATOM1585 CD1 ILE A 694 44.247 7.534 78.205 1.00 0.00 ATOM 1586 C ILE A 694 42.122 4.900 81.918 1.00 0.00 ATOM 1587 O ILE A 694 42.183 3.666 81.846 1.00 0.00 ATOM 1588 N LYS A 695 41.981 5.540 83.070 1.00 0.00 ATOM 1590 CA LYS A 695 42.095 4.818 84.344 1.000.00 ATOM 1591 CB LYS A 695 42.345 5.819 85.467 1.00 0.00 ATOM 1592 CG LYS A 695 43.629 6.610 85.248 1.00 0.00 ATOM 1593 CD LYS A 695 44.860 5.711 85.232 1.00 0.00 ATOM 1594 CE LYS A 695 46.114 6.518 84.918 1.00 0.00 ATOM 1595 NZ LYS A 695 46.295 7.60485.894 1.00 0.00 ATOM 1596 C LYS A 695 40.816 4.045 84.646 1.00 0.00 ATOM 1597 O LYS A 695 40.882 2.914 85.143 1.00 0.00 ATOM 1598 N GLU A 696 39.703 4.536 84.126 1.00 0.00 ATOM 1600 CA GLU A 696 38.431 3.831 84.276 1.00 0.00 ATOM 1601 CB GLU A 69637.310 4.828 84.007 1.00 0.00 ATOM 1602 CG GLU A 696 36.035 4.466 84.758 1.00 0.00 ATOM 1603 CD GLU A 696 36.250 4.648 86.260 1.00 0.00 ATOM 1604 OE1 GLU A 696 37.071 5.483 86.614 1.00 0.00 ATOM 1605 OE2 GLU A 696 35.496 4.061 87.028 1.00 0.00 ATOM 1606C GLU A 696 38.336 2.661 83.296 1.00 0.00 ATOM 1607 O GLU A 696 37.782 1.615 83.655 1.00 0.00 ATOM 1608 N LEU A 697 39.057 2.754 82.188 1.00 0.00 ATOM 1610 CA LEU A 697 39.173 1.624 81.262 1.00 0.00 ATOM 1611 CB LEU A 697 39.714 2.132 79.929 1.00 0.00ATOM 1612 CG LEU A 697 39.845 1.007 78.906 1.00 0.00 ATOM 1613 CD1 LEU A 697 38.505 0.324 78.662 1.00 0.00 ATOM 1614 CD2 LEU A 697 40.432 1.521 77.596 1.00 0.00 ATOM 1615 C LEU A 697 40.118 0.578 81.843 1.00 0.00 ATOM 1616 O LEU A 697 39.818 -0.61881.777 1.00 0.00 ATOM 1617 N GLY A 698 41.099 1.042 82.599 1.00 0.00 ATOM 1619 CA GLY A 698 41.971 0.162 83.383 1.00 0.00 ATOM 1620 C GLY A 698 41.155 -0.699 84.343 1.00 0.00 ATOM 1621 O GLY A 698 41.166 -1.928 84.213 1.00 0.00 ATOM 1622 N LYS A 69940.282 -0.063 85.112 1.00 0.00 ATOM 1624 CA LYS A 699 39.420 -0.783 86.065 1.00 0.00 ATOM 1625 CB LYS A 699 38.610 0.252 86.837 1.00 0.00 ATOM 1626 CG LYS A 699 39.505 1.316 87.455 1.00 0.00 ATOM 1627 CD LYS A 699 38.683 2.417 88.113 1.00 0.00 ATOM 1628CE LYS A 699 39.575 3.563 88.575 1.00 0.00 ATOM 1629 NZ LYS A 699 40.615 3.081 89.497 1.00 0.00 ATOM 1630 C LYS A 699 38.433 -1.730 85.378 1.00 0.00 ATOM 1631 O LYS A 699 38.276 -2.873 85.826 1.00 0.00 ATOM 1632 N ALA A 700 37.986 -1.357 84.188 1.00 0.00ATOM 1634 CA ALA A 700 37.053 -2.183 83.417 1.00 0.00 ATOM 1635 CB ALA A 700 36.418 -1.286 82.365 1.00 0.00 ATOM 1636 C ALA A 700 37.713 -3.382 82.735 1.00 0.00 ATOM 1637 O ALA A 700 37.030 -4.363 82.412 1.00 0.00 ATOM 1638 N ILE A 701 39.028 -3.34782.617 1.00 0.00 ATOM 1640 CA ILE A 701 39.787 -4.479 82.091 1.00 0.00 ATOM 1641 CB ILE A 701 40.988 -3.906 81.354 1.00 0.00 ATOM 1642 CG2 ILE A 701 41.973 -4.994 80.961 1.00 0.00 ATOM 1643 CG1 ILE A 701 40.524 -3.137 80.126 1.00 0.00 ATOM 1644 CD1 ILEA 701 41.686 -2.439 79.438 1.00 0.00 ATOM 1645 C ILE A 701 40.232 -5.396 83.224 1.00 0.00 ATOM 1646 O ILE A 701 40.054 -6.618 83.111 1.00 0.00 ATOM 1647 N VAL A 702 40.413 -4.802 84.395 1.00 0.00 ATOM 1649 CA VAL A 702 40.795 -5.550 85.605 1.00 0.00 ATOM1650 CB VAL A 702 41.270 -4.545 86.659 1.00 0.00 ATOM 1651 CG1 VAL A 702 41.485 -5.186 88.025 1.00 0.00 ATOM 1652 CG2 VAL A 702 42.541 -3.832 86.217 1.00 0.00 ATOM 1653 C VAL A 702 39.641 -6.385 86.170 1.00 0.00 ATOM 1654 O VAL A 702 39.893 -7.418 86.8041.00 0.00 ATOM 1655 N LYS A 703 38.422 -6.100 85.736 1.00 0.00 ATOM 1657 CA LYS A 703 37.280 -6.927 86.141 1.00 0.00 ATOM 1658 CB LYS A 703 35.990 -6.279 85.657 1.00 0.00 ATOM 1659 CG LYS A 703 35.699 -4.935 86.305 1.00 0.00 ATOM 1660 CD LYS A 703 34.310-4.472 85.883 1.00 0.00 ATOM 1661 CE LYS A 703 33.924 -3.141 86.508 1.00 0.00 ATOM 1662 NZ LYS A 703 34.768 -2.050 86.006 1.00 0.00 ATOM 1663 C LYS A 703 37.316 -8.335 85.543 1.00 0.00 ATOM 1664 O LYS A 703 36.806 -9.271 86.170 1.00 0.00 ATOM 1665 N ARGA 704 37.927 -8.503 84.380 1.00 0.00 ATOM 1667 CA ARG A 704 37.996 -9.844 83.793 1.00 0.00 ATOM 1668 CB ARG A 704 37.374 -9.815 82.402 1.00 0.00 ATOM 1669 CG ARG A 704 35.948 -9.277 82.435 1.00 0.00 ATOM 1670 CD ARG A 704 35.251 -9.473 81.093 1.00 0.00ATOM 1671 NE ARG A 704 36.041 -8.896 79.994 1.00 0.00 ATOM 1672 CZ ARG A 704 36.356 -9.590 78.899 1.00 0.00 ATOM 1673 NH1 ARG A 704 35.981 -10.866 78.786 1.00 0.00 ATOM 1674 NH2 ARG A 704 37.070 -9.018 77.929 1.00 0.00 ATOM 1675 C ARG A 704 39.432-10.344 83.692 1.00 0.00 ATOM 1676 O ARG A 704 39.682 -11.556 83.660 1.00 0.00 ATOM 1677 N GLU A 705 40.375 -9.420 83.679 1.00 0.00 ATOM 1679 CA GLU A 705 41.780 -9.806 83.537 1.00 0.00 ATOM 1680 CB GLU A 705 42.485 -8.792 82.649 1.00 0.00 ATOM 1681 CGGLU A 705 41.793 -8.633 81.298 1.00 0.00 ATOM 1682 CD GLU A 705 41.769 -9.943 80.515 1.00 0.00 ATOM 1683 OE1 GLU A 705 42.762 -10.659 80.548 1.00 0.00 ATOM 1684 OE2 GLU A 705 40.754 -10.202 79.886 1.00 0.00 ATOM 1685 C GLU A 705 42.469 -9.883 84.892 1.000.00 ATOM 1686 O GLU A 705 43.165 -8.952 85.313 1.00 0.00 ATOM 1687 N GLY A 706 42.318 -11.041 85.516 1.00 0.00 ATOM 1689 CA GLY A 706 42.921 -11.312 86.826 1.00 0.00 ATOM 1690 C GLY A 706 44.444 -11.303 86.755 1.00 0.00 ATOM 1691 O GLY A 706 45.105-10.616 87.544 1.00 0.00 ATOM 1692 N ASN A 707 44.985 -12.073 85.825 1.00 0.00 ATOM 1694 CA ASN A 707 46.434 -12.072 85.604 1.00 0.00 ATOM 1695 CB ASN A 707 46.780 -13.096 84.526 1.00 0.00 ATOM 1696 CG ASN A 707 46.228 -14.477 84.870 1.00 0.00 ATOM 1697OD1 ASN A 707 46.198 -14.886 86.036 1.00 0.00 ATOM 1698 ND2 ASN A 707 45.814 -15.189 83.836 1.00 0.00 ATOM 1701 C ASN A 707 46.866 -10.691 85.129 1.00 0.00 ATOM 1702 O ASN A 707 46.345 -10.190 84.126 1.00 0.00 ATOM 1703 N SER A 708 47.929 -10.173 85.7221.00 0.00 ATOM 1705 CA SER A 708 48.365 -8.802 85.408 1.00 0.00 ATOM 1706 CB SER A 708 49.375 -8.343 86.456 1.00 0.00 ATOM 1707 OG SER A 708 50.518 -9.187 86.383 1.00 0.00 ATOM 1708 C SER A 708 48.977 -8.664 84.014 1.00 0.00 ATOM 1709 O SER A 708 48.712-7.657 83.348 1.00 0.00 ATOM 1710 N SER A 709 49.487 -9.759 83.468 1.00 0.00 ATOM 1712 CA SER A 709 50.000 -9.724 82.096 1.00 0.00 ATOM 1713 CB SER A 709 50.898 -10.929 81.864 1.00 0.00 ATOM 1714 OG SER A 709 51.288 -10.898 80.498 1.00 0.00 ATOM 1715 CSER A 709 48.860 -9.753 81.087 1.00 0.00 ATOM 1716 O SER A 709 48.912 -9.013 80.099 1.00 0.00

ATOM 1717 N GLN A 710 47.734 -10.302 81.514 1.00 0.00 ATOM 1719 CA GLN A 710 46.533 -10.337 80.686 1.00 0.00 ATOM 1720 CB GLN A 710 45.613 -11.429 81.217 1.00 0.00 ATOM 1721 CG GLN A 710 46.048 -12.826 80.804 1.00 0.00 ATOM 1722 CD GLN A 71045.774 -13.048 79.319 1.00 0.00 ATOM 1723 OE1 GLN A 710 46.534 -13.753 78.645 1.00 0.00 ATOM 1724 NE2 GLN A 710 44.669 -12.497 78.843 1.00 0.00 ATOM 1727 C GLN A 710 45.794 -9.011 80.750 1.00 0.00 ATOM 1728 O GLN A 710 45.195 -8.591 79.753 1.00 0.00 ATOM1729 N ASN A 711 46.017 -8.276 81.826 1.00 0.00 ATOM 1731 CA ASN A 711 45.452 -6.938 81.954 1.00 0.00 ATOM 1732 CB ASN A 711 45.583 -6.508 83.411 1.00 0.00 ATOM 1733 CG ASN A 711 45.045 -5.095 83.598 1.00 0.00 ATOM 1734 OD1 ASN A 711 43.838 -4.853 83.4971.00 0.00 ATOM 1735 ND2 ASN A 711 45.952 -4.167 83.859 1.00 0.00 ATOM 1738 C ASN A 711 46.196 -5.965 81.050 1.00 0.00 ATOM 1739 O ASN A 711 45.553 -5.246 80.273 1.00 0.00 ATOM 1740 N TRP A 712 47.503 -6.147 80.941 1.00 0.00 ATOM 1742 CA TRP A 712 48.293-5.279 80.063 1.00 0.00 ATOM 1743 CB TRP A 712 49.760 -5.349 80.469 1.00 0.00 ATOM 1744 CG TRP A 712 50.062 -4.651 81.780 1.00 0.00 ATOM 1745 CD1 TRP A 712 50.445 -5.237 82.965 1.00 0.00 ATOM 1746 NE1 TRP A 712 50.616 -4.263 83.892 1.00 0.00 ATOM 1748 CE2 TRP A 712 50.371 -3.047 83.372 1.00 0.00 ATOM 1749 CZ2 TRP A 712 50.416 -1.767 83.905 1.00 0.00 ATOM 1750 CH2 TRP A 712 50.108 -0.674 83.103 1.00 0.00 ATOM 1751 CZ3 TRP A 712 49.757 -0.857 81.769 1.00 0.00 ATOM 1752 CE3 TRP A 712 49.710 -2.135 81.2261.00 0.00 ATOM 1753 CD2 TRP A 712 50.016 -3.228 82.022 1.00 0.00 ATOM 1754 C TRP A 712 48.150 -5.650 78.591 1.00 0.00 ATOM 1755 O TRP A 712 48.091 -4.747 77.745 1.00 0.00 ATOM 1756 N GLN A 713 47.865 -6.913 78.312 1.00 0.00 ATOM 1758 CA GLN A 713 47.625-7.321 76.926 1.00 0.00 ATOM 1759 CB GLN A 713 47.658 -8.842 76.819 1.00 0.00 ATOM 1760 CG GLN A 713 49.051 -9.411 77.069 1.00 0.00 ATOM 1761 CD GLN A 713 50.036 -8.933 76.005 1.00 0.00 ATOM 1762 OE1 GLN A 713 49.954 -9.335 74.839 1.00 0.00 ATOM 1763 NE2GLN A 713 50.996 -8.130 76.433 1.00 0.00 ATOM 1766 C GLN A 713 46.275 -6.813 76.456 1.00 0.00 ATOM 1767 O GLN A 713 46.233 -6.074 75.466 1.00 0.00 ATOM 1768 N ARG A 714 45.304 -6.867 77.352 1.00 0.00 ATOM 1770 CA ARG A 714 43.946 -6.435 77.035 1.00 0.00ATOM 1771 CB ARG A 714 43.065 -6.919 78.173 1.00 0.00 ATOM 1772 CG ARG A 714 41.592 -6.780 77.843 1.00 0.00 ATOM 1773 CD ARG A 714 41.216 -7.730 76.722 1.00 0.00 ATOM 1774 NE ARG A 714 39.804 -7.551 76.386 1.00 0.00 ATOM 1775 CZ ARG A 714 39.396 -7.22775.162 1.00 0.00 ATOM 1776 NH1 ARG A 714 40.287 -7.095 74.177 1.00 0.00 ATOM 1777 NH2 ARG A 714 38.096 -7.050 74.925 1.00 0.00 ATOM 1778 C ARG A 714 43.837 -4.916 76.921 1.00 0.00 ATOM 1779 O ARG A 714 43.162 -4.416 76.011 1.00 0.00 ATOM 1780 N PHE A 71544.666 -4.204 77.668 1.00 0.00 ATOM 1782 CA PHE A 715 44.694 -2.744 77.557 1.00 0.00 ATOM 1783 CB PHE A 715 45.456 -2.173 78.747 1.00 0.00 ATOM 1784 CG PHE A 715 45.507 -0.648 78.774 1.00 0.00 ATOM 1785 CD1 PHE A 715 44.386 0.074 79.162 1.00 0.00 ATOM1786 CE1 PHE A 715 44.426 1.462 79.184 1.00 0.00 ATOM 1787 CZ PHE A 715 45.589 2.127 78.817 1.00 0.00 ATOM 1788 CE2 PHE A 715 46.710 1.406 78.429 1.00 0.00 ATOM 1789 CD2 PHE A 715 46.669 0.018 78.407 1.00 0.00 ATOM 1790 C PHE A 715 45.358 -2.305 76.2571.00 0.00 ATOM 1791 O PHE A 715 44.796 -1.461 75.544 1.00 0.00 ATOM 1792 N TYR A 716 46.358 -3.055 75.824 1.00 0.00 ATOM 1794 CA TYR A 716 47.011 -2.746 74.553 1.00 0.00 ATOM 1795 CB TYR A 716 48.307 -3.542 74.446 1.00 0.00 ATOM 1796 CG TYR A 716 49.046-3.324 73.128 1.00 0.00 ATOM 1797 CD1 TYR A 716 49.801 -2.173 72.944 1.00 0.00 ATOM 1798 CE1 TYR A 716 50.465 -1.963 71.743 1.00 0.00 ATOM 1799 CZ TYR A 716 50.370 -2.905 70.728 1.00 0.00 ATOM 1800 OH TYR A 716 50.984 -2.671 69.518 1.00 0.00 ATOM 1801CE2 TYR A 716 49.621 -4.060 70.910 1.00 0.00 ATOM 1802 CD2 TYR A 716 48.959 -4.270 72.112 1.00 0.00 ATOM 1803 C TYR A 716 46.101 -3.094 73.381 1.00 0.00 ATOM 1804 O TYR A 716 45.947 -2.262 72.480 1.00 0.00 ATOM 1805 N GLN A 717 45.312 -4.145 73.533 1.000.00 ATOM 1807 CA GLN A 717 44.381 -4.561 72.482 1.00 0.00 ATOM 1808 CB GLN A 717 43.806 -5.917 72.864 1.00 0.00 ATOM 1809 CG GLN A 717 44.881 -6.993 72.925 1.00 0.00 ATOM 1810 CD GLN A 717 44.287 -8.261 73.526 1.00 0.00 ATOM 1811 OE1 GLN A 717 44.686-8.711 74.609 1.00 0.00 ATOM 1812 NE2 GLN A 717 43.299 -8.796 72.832 1.00 0.00 ATOM 1815 C GLN A 717 43.227 -3.581 72.311 1.00 0.00 ATOM 1816 O GLN A 717 42.932 -3.196 71.174 1.00 0.00 ATOM 1817 N LEU A 718 42.745 -3.011 73.402 1.00 0.00 ATOM 1819 CA LEUA 718 41.625 -2.072 73.293 1.00 0.00 ATOM 1820 CB LEU A 718 40.925 -1.980 74.640 1.00 0.00 ATOM 1821 CG LEU A 718 40.260 -3.307 74.984 1.00 0.00 ATOM 1822 CD1 LEU A 718 39.617 -3.258 76.364 1.00 0.00 ATOM 1823 CD2 LEU A 718 39.239 -3.689 73.919 1.00 0.00ATOM 1824 C LEU A 718 42.065 -0.690 72.834 1.00 0.00 ATOM 1825 O LEU A 718 41.383 -0.090 71.994 1.00 0.00 ATOM 1826 N THR A 719 43.294 -0.319 73.150 1.00 0.00 ATOM 1828 CA THR A 719 43.803 0.973 72.678 1.00 0.00 ATOM 1829 CB THR A 719 44.932 1.45573.583 1.00 0.00 ATOM 1830 OG1 THR A 719 45.962 0.476 73.610 1.00 0.00 ATOM 1831 CG2 THR A 719 44.443 1.695 75.006 1.00 0.00 ATOM 1832 C THR A 719 44.285 0.896 71.231 1.00 0.00 ATOM 1833 O THR A 719 44.076 1.847 70.466 1.00 0.00 ATOM 1834 N LYS A 72044.662 -0.295 70.796 1.00 0.00 ATOM 1836 CA LYS A 720 45.050 -0.483 69.400 1.00 0.00 ATOM 1837 CB LYS A 720 45.947 -1.711 69.304 1.00 0.00 ATOM 1838 CG LYS A 720 46.557 -1.838 67.917 1.00 0.00 ATOM 1839 CD LYS A 720 47.389 -0.605 67.580 1.00 0.00 ATOM1840 CE LYS A 720 47.988 -0.717 66.186 1.00 0.00 ATOM 1841 NZ LYS A 720 48.859 -1.900 66.083 1.00 0.00 ATOM 1842 C LYS A 720 43.814 -0.663 68.524 1.00 0.00 ATOM 1843 O LYS A 720 43.795 -0.186 67.381 1.00 0.00 ATOM 1844 N LEU A 721 42.727 -1.092 69.1431.00 0.00 ATOM 1846 CA LEU A 721 41.447 -1.157 68.445 1.00 0.00 ATOM 1847 CB LEU A 721 40.451 -1.930 69.304 1.00 0.00 ATOM 1848 CG LEU A 721 39.100 -2.072 68.610 1.00 0.00 ATOM 1849 CD1 LEU A 721 39.251 -2.767 67.260 1.00 0.00 ATOM 1850 CD2 LEU A 72138.111 -2.824 69.493 1.00 0.00 ATOM 1851 C LEU A 721 40.925 0.250 68.195 1.00 0.00 ATOM 1852 O LEU A 721 40.699 0.591 67.029 1.00 0.00 ATOM 1853 N LEU A 722 41.072 1.123 69.181 1.00 0.00 ATOM 1855 CA LEU A 722 40.635 2.514 69.010 1.00 0.00 ATOM 1856 CBLEU A 722 40.666 3.213 70.366 1.00 0.00 ATOM 1857 CG LEU A 722 39.721 2.552 71.362 1.00 0.00 ATOM 1858 CD1 LEU A 722 39.850 3.185 72.743 1.00 0.00 ATOM 1859 CD2 LEU A 722 38.276 2.602 70.876 1.00 0.00 ATOM 1860 C LEU A 722 41.535 3.267 68.033 1.00 0.00ATOM 1861 O LEU A 722 41.022 3.962 67.146 1.00 0.00 ATOM 1862 N ASP A 723 42.808 2.903 68.008 1.00 0.00 ATOM 1864 CA ASP A 723 43.753 3.502 67.059 1.00 0.00 ATOM 1865 CB ASP A 723 45.157 3.007 67.384 1.00 0.00 ATOM 1866 CG ASP A 723 45.766 3.774 68.5521.00 0.00 ATOM 1867 OD1 ASP A 723 45.032 4.465 69.245 1.00 0.00 ATOM 1868 OD2 ASP A 723 46.979 3.922 68.525 1.00 0.00 ATOM 1869 C ASP A 723 43.437 3.124 65.616 1.00 0.00 ATOM 1870 O ASP A 723 43.224 4.020 64.786 1.00 0.00 ATOM 1871 N SER A 724 43.1281.855 65.402 1.00 0.00 ATOM 1873 CA SER A 724 42.847 1.355 64.051 1.00 0.00 ATOM 1874 CB SER A 724 43.057 -0.155 64.032 1.00 0.00 ATOM 1875 OG SER A 724 42.110 -0.747 64.913 1.00 0.00 ATOM 1876 C SER A 724 41.427 1.668 63.583 1.00 0.00 ATOM 1877 O SER A724 41.164 1.639 62.375 1.00 0.00 ATOM 1878 N MET A 725 40.578 2.143 64.478 1.00 0.00 ATOM 1880 CA MET A 725 39.226 2.522 64.079 1.00 0.00 ATOM 1881 CB MET A 725 38.302 2.427 65.279 1.00 0.00 ATOM 1882 CG MET A 725 38.024 0.986 65.707 1.00 0.00 ATOM1883 SD MET A 725 37.134 -0.071 64.538 1.00 0.00 ATOM 1884 CE MET A 725 38.513 -0.893 63.704 1.00 0.00 ATOM 1885 C MET A 725 39.156 3.918 63.468 1.00 0.00 ATOM 1886 O MET A 725 38.213 4.182 62.711 1.00 0.00 ATOM 1887 N HIS A 726 40.243 4.672 63.521 1.000.00 ATOM 1889 CA HIS A 726 40.255 5.971 62.835 1.00 0.00 ATOM 1890 CB HIS A 726 41.453 6.792 63.301 1.00 0.00 ATOM 1891 CG HIS A 726 41.413 7.237 64.751 1.00 0.00 ATOM 1892 ND1 HIS A 726 42.077 6.678 65.778 1.00 0.00 ATOM 1894 CE1 HIS A 726 41.801 7.35266.912 1.00 0.00 ATOM 1895 NE2 HIS A 726 40.951 8.354 66.594 1.00 0.00 ATOM 1896 CD2 HIS A 726 40.703 8.296 65.265 1.00 0.00 ATOM 1897 C HIS A 726 40.328 5.806 61.313 1.00 0.00 ATOM 1898 O HIS A 726 39.691 6.590 60.596 1.00 0.00 ATOM 1899 N GLU A 72740.784 4.645 60.861 1.00 0.00 ATOM 1901 CA GLU A 727 40.862 4.406 59.420 1.00 0.00 ATOM 1902 CB GLU A 727 41.940 3.360 59.128 1.00 0.00 ATOM 1903 CG GLU A 727 41.508 1.935 59.457 1.00 0.00 ATOM 1904 CD GLU A 727 42.735 1.062 59.699 1.00 0.00 ATOM 1905OE1 GLU A 727 43.667 1.562 60.314 1.00 0.00 ATOM 1906 OE2 GLU A 727 42.694 -0.104 59.329 1.00 0.00 ATOM 1907 C GLU A 727 39.510 3.996 58.827 1.00 0.00 ATOM 1908 O GLU A 727 39.299 4.245 57.637 1.00 0.00 ATOM 1909 N VAL A 728 38.551 3.604 59.657 1.000.00 ATOM 1911 CA VAL A 728 37.213 3.338 59.131 1.00 0.00 ATOM 1912 CB VAL A 728 36.630 2.052 59.725 1.00 0.00 ATOM 1913 CG1 VAL A 728 36.806 1.943 61.232 1.00 0.00 ATOM 1914 CG2 VAL A 728 35.167 1.866 59.344 1.00 0.00 ATOM 1915 C VAL A 728 36.312 4.54959.359 1.00 0.00 ATOM 1916 O VAL A 728 35.470 4.864 58.506 1.00 0.00 ATOM 1917 N VAL A 729 36.704 5.392 60.302 1.00 0.00 ATOM 1919 CA VAL A 729 35.952 6.625 60.544 1.00 0.00 ATOM 1920 CB VAL A 729 36.318 7.170 61.921 1.00 0.00 ATOM 1921 CG1 VAL A 72935.681 8.532 62.178 1.00 0.00 ATOM 1922 CG2 VAL A 729 35.909 6.187 63.006 1.00 0.00 ATOM 1923 C VAL A 729 36.240 7.665 59.467 1.00 0.00 ATOM 1924 O VAL A 729 35.314 8.371 59.048 1.00 0.00 ATOM 1925 N GLU A 730 37.387 7.547 58.817 1.00 0.00 ATOM 1927 CAGLU A 730 37.669 8.451 57.702 1.00 0.00 ATOM 1928 CB GLU A 730 39.179 8.568 57.497 1.00 0.00 ATOM 1929 CG GLU A 730 39.825 7.247 57.100 1.00 0.00 ATOM 1930 CD GLU A 730 41.345 7.378 57.066 1.00 0.00 ATOM 1931 OE1 GLU A 730 41.868 7.723 56.017 1.00 0.00ATOM 1932 OE2 GLU A 730 41.955 7.126 58.097 1.00 0.00 ATOM 1933 C GLU A 730 36.962 8.028 56.408 1.00 0.00 ATOM 1934 O GLU A 730 36.682 8.908 55.584 1.00 0.00 ATOM 1935 N ASN A 731 36.484 6.794 56.300 1.00 0.00 ATOM 1937 CA ASN A 731 35.678 6.471 55.1201.00 0.00 ATOM 1938 CB ASN A 731 35.961 5.068 54.567 1.00 0.00 ATOM 1939 CG ASN A 731 35.700 3.917 55.540 1.00 0.00 ATOM 1940 OD1 ASN A 731 36.640 3.383 56.136 1.00 0.00 ATOM 1941 ND2 ASN A 731 34.461 3.453 55.575 1.00 0.00 ATOM 1944 C ASN A 731 34.2016.685 55.429 1.00 0.00 ATOM 1945 O ASN A 731 33.451 7.073 54.525 1.00 0.00 ATOM 1946 N LEU A 732 33.871 6.721 56.712 1.00 0.00 ATOM 1948 CA LEU A 732 32.508 7.055 57.132 1.00 0.00 ATOM 1949 CB LEU A 732 32.348 6.743 58.617 1.00 0.00 ATOM 1950 CG LEU A732 32.443 5.254 58.924 1.00 0.00 ATOM 1951 CD1 LEU A 732 32.476 5.011 60.429 1.00 0.00 ATOM 1952 CD2 LEU A 732 31.300 4.481 58.283 1.00 0.00 ATOM 1953 C LEU A 732 32.250 8.539 56.917 1.00 0.00 ATOM 1954 O LEU A 732 31.232 8.906 56.320 1.00 0.00 ATOM1955 N LEU A 733 33.270 9.346 57.162 1.00 0.00 ATOM 1957 CA LEU A 733 33.158 10.786 56.917 1.00 0.00 ATOM 1958 CB LEU A 733 34.283 11.487 57.664 1.00 0.00 ATOM 1959 CG LEU A 733 34.013 11.480 59.164 1.00 0.00 ATOM 1960 CD1 LEU A 733 35.251 11.870 59.9591.00 0.00 ATOM 1961 CD2 LEU A 733 32.837 12.389 59.502 1.00 0.00 ATOM 1962 C LEU A 733 33.222 11.133 55.433 1.00 0.00 ATOM 1963 O LEU A 733 32.441 11.983 54.989 1.00 0.00 ATOM 1964 N ASN A 734 33.921 10.327 54.649 1.00 0.00 ATOM 1966 CA ASN A 734 33.94810.554 53.202 1.00 0.00 ATOM 1967 CB ASN A 734 35.056 9.724 52.564 1.00 0.00 ATOM 1968 CG ASN A 734 36.277 10.603 52.322 1.00 0.00 ATOM 1969 OD1 ASN A 734 36.316 11.379 51.356 1.00 0.00 ATOM 1970 ND2 ASN A 734 37.239 10.513 53.222 1.00 0.00 ATOM 1973 CASN A 734 32.621 10.201 52.550 1.00 0.00 ATOM 1974 O ASN A 734 32.024 11.078 51.910 1.00 0.00 ATOM 1975 N TYR A 735 32.033 9.089 52.962 1.00 0.00 ATOM 1977 CA TYR A 735 30.776 8.654 52.354 1.00 0.00 ATOM 1978 CB TYR A 735 30.563 7.180 52.673 1.00 0.00ATOM 1979 CG TYR A 735 29.561 6.466 51.767 1.00 0.00 ATOM 1980 CD1 TYR A 735 30.027 5.739 50.680 1.00 0.00 ATOM 1981 CE1 TYR A 735 29.133 5.077 49.850 1.00 0.00 ATOM 1982 CZ TYR A 735 27.772 5.144 50.110 1.00 0.00 ATOM 1983 OH TYR A 735 26.888 4.46349.302 1.00 0.00 ATOM 1984 CE2 TYR A 735 27.300 5.869 51.196 1.00 0.00 ATOM 1985 CD2 TYR A 735 28.197 6.530 52.027 1.00 0.00 ATOM 1986 C TYR A 735 29.597 9.475 52.867 1.00 0.00 ATOM 1987 O TYR A 735 28.729 9.847 52.067 1.00 0.00 ATOM 1988 N CYS A 73629.696 9.977 54.086 1.00 0.00 ATOM 1990 CA CYS A 736 28.640 10.843 54.608 1.00 0.00 ATOM 1991 CB CYS A 736 28.826 11.008 56.111 1.00 0.00 ATOM 1992 SG CYS A 736 27.633 12.095 56.926 1.00 0.00 ATOM 1993 C CYS A 736 28.678 12.217 53.952 1.00 0.00 ATOM1994 O CYS A 736 27.638 12.677 53.463 1.00 0.00 ATOM 1995 N PHE A 737 29.874 12.713 53.681 1.00 0.00 ATOM 1997 CA PHE A 737 30.000 14.042 53.085 1.00 0.00 ATOM 1998 CB PHE A 737 31.431 14.524 53.302 1.00 0.00 ATOM 1999 CG PHE A 737 31.671 15.997 52.9811.00 0.00 ATOM 2000 CD1 PHE A 737 32.188 16.373 51.749 1.00 0.00 ATOM 2001 CE1 PHE A 737 32.408 17.715 51.468 1.00 0.00 ATOM 2002 CZ PHE A 737 32.115 18.681 52.422 1.00 0.00 ATOM 2003 CE2 PHE A 737 31.605 18.305 53.658 1.00 0.00 ATOM 2004 CD2 PHE A 73731.385 16.963 53.938 1.00 0.00 ATOM 2005 C PHE A 737 29.667 14.017 51.595 1.00 0.00 ATOM 2006 O PHE A 737 28.942 14.905 51.128 1.00 0.00 ATOM 2007 N GLN A 738 29.943 12.909 50.926 1.00 0.00 ATOM 2009 CA GLN A 738 29.590 12.836 49.508 1.00 0.00 ATOM 2010CB GLN A 738 30.484 11.829 48.788 1.00 0.00

ATOM 2011 CG GLN A 738 30.307 10.413 49.320 1.00 0.00 ATOM 2012 CD GLN A 738 31.187 9.439 48.556 1.00 0.00 ATOM 2013 OE1 GLN A 738 32.012 8.728 49.143 1.00 0.00 ATOM 2014 NE2 GLN A 738 30.969 9.395 47.253 1.00 0.00 ATOM 2017 C GLN A 738 28.11712.485 49.304 1.00 0.00 ATOM 2018 O GLN A 738 27.521 13.009 48.357 1.00 0.00 ATOM 2019 N THR A 739 27.470 11.882 50.290 1.00 0.00 ATOM 2021 CA THR A 739 26.043 11.590 50.149 1.00 0.00 ATOM 2022 CB THR A 739 25.707 10.354 50.976 1.00 0.00 ATOM 2023 OG1THR A 739 26.490 9.280 50.474 1.00 0.00 ATOM 2024 CG2 THR A 739 24.244 9.956 50.836 1.00 0.00 ATOM 2025 C THR A 739 25.210 12.791 50.584 1.00 0.00 ATOM 2026 O THR A 739 24.126 13.016 50.036 1.00 0.00 ATOM 2027 N PHE A 740 25.831 13.668 51.357 1.00 0.00ATOM 2029 CA PHE A 740 25.223 14.951 51.711 1.00 0.00 ATOM 2030 CB PHE A 740 25.918 15.449 52.977 1.00 0.00 ATOM 2031 CG PHE A 740 25.552 16.861 53.426 1.00 0.00 ATOM 2032 CD1 PHE A 740 24.342 17.098 54.065 1.00 0.00 ATOM 2033 CE1 PHE A 740 24.014 18.38554.476 1.00 0.00 ATOM 2034 CZ PHE A 740 24.897 19.433 54.249 1.00 0.00 ATOM 2035 CE2 PHE A 740 26.108 19.195 53.613 1.00 0.00 ATOM 2036 CD2 PHE A 740 26.435 17.910 53.202 1.00 0.00 ATOM 2037 C PHE A 740 25.395 15.974 50.589 1.00 0.00 ATOM 2038 O PHE A740 24.533 16.840 50.406 1.00 0.00 ATOM 2039 N LEU A 741 26.410 15.794 49.761 1.00 0.00 ATOM 2041 CA LEU A 741 26.590 16.683 48.610 1.00 0.00 ATOM 2042 CB LEU A 741 28.076 16.651 48.237 1.00 0.00 ATOM 2043 CG LEU A 741 28.511 17.759 47.275 1.00 0.00 ATOM2044 CD1 LEU A 741 28.244 17.441 45.806 1.00 0.00 ATOM 2045 CD2 LEU A 741 27.939 19.115 47.679 1.00 0.00 ATOM 2046 C LEU A 741 25.716 16.199 47.454 1.00 0.00 ATOM 2047 O LEU A 741 24.995 16.990 46.834 1.00 0.00 ATOM 2048 N ASP A 742 25.600 14.886 47.3501.00 0.00 ATOM 2050 CA ASP A 742 24.803 14.248 46.298 1.00 0.00 ATOM 2051 CB ASP A 742 25.404 12.878 45.973 1.00 0.00 ATOM 2052 CG ASP A 742 26.853 12.975 45.486 1.00 0.00 ATOM 2053 OD1 ASP A 742 27.193 13.990 44.894 1.00 0.00 ATOM 2054 OD2 ASP A 74227.564 11.985 45.621 1.00 0.00 ATOM 2055 C ASP A 742 23.342 14.041 46.697 1.00 0.00 ATOM 2056 O ASP A 742 22.604 13.408 45.930 1.00 0.00 ATOM 2057 N LYS A 743 22.876 14.718 47.737 1.00 0.00 ATOM 2059 CA LYS A 743 21.573 14.391 48.333 1.00 0.00 ATOM 2060CB LYS A 743 21.478 15.004 49.738 1.00 0.00 ATOM 2061 CG LYS A 743 20.899 16.419 49.850 1.00 0.00 ATOM 2062 CD LYS A 743 21.811 17.518 49.317 1.00 0.00 ATOM 2063 CE LYS A 743 21.271 18.900 49.659 1.00 0.00 ATOM 2064 NZ LYS A 743 21.189 19.068 51.1201.00 0.00 ATOM 2065 C LYS A 743 20.366 14.786 47.477 1.00 0.00 ATOM 2066 O LYS A 743 19.344 14.092 47.546 1.00 0.00 ATOM 2067 N THR A 744 20.570 15.639 46.484 1.00 0.00 ATOM 2069 CA THR A 744 19.469 15.997 45.582 1.00 0.00 ATOM 2070 CB THR A 744 19.74517.370 44.978 1.00 0.00 ATOM 2071 OG1 THR A 744 20.919 17.288 44.180 1.00 0.00 ATOM 2072 CG2 THR A 744 19.958 18.433 46.048 1.00 0.00 ATOM 2073 C THR A 744 19.299 14.988 44.445 1.00 0.00 ATOM 2074 O THR A 744 18.212 14.896 43.869 1.00 0.00 ATOM 2075 NMET A 745 20.311 14.168 44.209 1.00 0.00 ATOM 2077 CA MET A 745 20.236 13.170 43.139 1.00 0.00 ATOM 2078 CB MET A 745 21.533 13.239 42.344 1.00 0.00 ATOM 2079 CG MET A 745 21.761 14.636 41.776 1.00 0.00 ATOM 2080 SD MET A 745 23.344 14.883 40.942 1.000.00 ATOM 2081 CE MET A 745 24.446 14.543 42.335 1.00 0.00 ATOM 2082 C MET A 745 20.077 11.775 43.729 1.00 0.00 ATOM 2083 O MET A 745 19.551 10.856 43.091 1.00 0.00 ATOM 2084 N SER A 746 20.503 11.654 44.975 1.00 0.00 ATOM 2086 CA SER A 746 20.402 10.39245.711 1.00 0.00 ATOM 2087 CB SER A 746 21.629 10.242 46.602 1.00 0.00 ATOM 2088 OG SER A 746 21.556 11.239 47.615 1.00 0.00 ATOM 2089 C SER A 746 19.158 10.337 46.590 1.00 0.00 ATOM 2090 O SER A 746 19.008 9.374 47.348 1.00 0.00 ATOM 2091 N ILE A 74718.336 11.377 46.524 1.00 0.00 ATOM 2093 CA ILE A 747 17.112 11.507 47.332 1.00 0.00 ATOM 2094 CB ILE A 747 16.026 10.602 46.752 1.00 0.00 ATOM 2095 CG2 ILE A 747 14.708 10.772 47.504 1.00 0.00 ATOM 2096 CG1 ILE A 747 15.805 10.913 45.273 1.00 0.00 ATOM2097 CD1 ILE A 747 15.255 12.322 45.067 1.00 0.00 ATOM 2098 C ILE A 747 17.419 11.188 48.795 1.00 0.00 ATOM 2099 O ILE A 747 17.033 10.149 49.343 1.00 0.00 ATOM 2100 N GLU A 748 18.256 12.039 49.358 1.00 0.00 ATOM 2102 CA GLU A 748 18.735 11.844 50.7211.00 0.00 ATOM 2103 CB GLU A 748 20.233 11.562 50.637 1.00 0.00 ATOM 2104 CG GLU A 748 20.802 10.962 51.916 1.00 0.00 ATOM 2105 CD GLU A 748 21.747 11.941 52.609 1.00 0.00 ATOM 2106 OE1 GLU A 748 21.634 13.127 52.348 1.00 0.00 ATOM 2107 OE2 GLU A 74822.562 11.485 53.405 1.00 0.00 ATOM 2108 C GLU A 748 18.430 13.109 51.510 1.00 0.00 ATOM 2109 O GLU A 748 18.682 14.219 51.032 1.00 0.00 ATOM 2110 N PHE A 749 17.851 12.949 52.686 1.00 0.00 ATOM 2112 CA PHE A 749 17.424 14.129 53.448 1.00 0.00 ATOM 2113CB PHE A 749 15.901 14.222 53.402 1.00 0.00 ATOM 2114 CG PHE A 749 15.320 14.358 51.997 1.00 0.00 ATOM 2115 CD1 PHE A 749 14.561 13.327 51.454 1.00 0.00 ATOM 2116 CE1 PHE A 749 14.039 13.450 50.173 1.00 0.00 ATOM 2117 CZ PHE A 749 14.272 14.603 49.4361.00 0.00 ATOM 2118 CE2 PHE A 749 15.024 15.635 49.982 1.00 0.00 ATOM 2119 CD2 PHE A 749 15.546 15.514 51.262 1.00 0.00 ATOM 2120 C PHE A 749 17.880 14.066 54.900 1.00 0.00 ATOM 2121 O PHE A 749 17.137 13.594 55.768 1.00 0.00 ATOM 2122 N PRO A 750 19.07914.561 55.161 1.00 0.00 ATOM 2123 CA PRO A 750 19.544 14.689 56.537 1.00 0.00 ATOM 2124 CB PRO A 750 21.007 14.988 56.426 1.00 0.00 ATOM 2125 CG PRO A 750 21.327 15.328 54.979 1.00 0.00 ATOM 2126 CD PRO A 750 20.030 15.135 54.206 1.00 0.00 ATOM 2127 CPRO A 750 18.805 15.823 57.230 1.00 0.00 ATOM 2128 O PRO A 750 18.674 16.918 56.677 1.00 0.00 ATOM 2129 N GLU A 751 18.336 15.561 58.436 1.00 0.00 ATOM 2131 CA GLU A 751 17.700 16.620 59.228 1.00 0.00 ATOM 2132 CB GLU A 751 17.037 16.006 60.451 1.00 0.00ATOM 2133 CG GLU A 751 18.001 15.153 61.262 1.00 0.00 ATOM 2134 CD GLU A 751 17.227 14.486 62.389 1.00 0.00 ATOM 2135 OE1 GLU A 751 16.771 13.371 62.177 1.00 0.00 ATOM 2136 OE2 GLU A 751 17.033 15.143 63.401 1.00 0.00 ATOM 2137 C GLU A 751 18.728 17.68159.613 1.00 0.00 ATOM 2138 O GLU A 751 19.938 17.437 59.505 1.00 0.00 ATOM 2139 N MET A 752 18.259 18.788 60.168 1.00 0.00 ATOM 2141 CA MET A 752 19.114 19.968 60.399 1.00 0.00 ATOM 2142 CB MET A 752 18.222 21.088 60.916 1.00 0.00 ATOM 2143 CG MET A 75217.132 21.422 59.904 1.00 0.00 ATOM 2144 SD MET A 752 15.961 22.698 60.419 1.00 0.00 ATOM 2145 CE MET A 752 15.283 21.876 61.879 1.00 0.00 ATOM 2146 C MET A 752 20.269 19.758 61.379 1.00 0.00 ATOM 2147 O MET A 752 21.357 20.290 61.125 1.00 0.00 ATOM 2148N LEU A 753 20.133 18.792 62.277 1.00 0.00 ATOM 2150 CA LEU A 753 21.222 18.440 63.198 1.00 0.00 ATOM 2151 CB LEU A 753 20.765 17.356 64.185 1.00 0.00 ATOM 2152 CG LEU A 753 19.913 17.851 65.360 1.00 0.00 ATOM 2153 CD1 LEU A 753 18.445 18.058 64.991 1.000.00 ATOM 2154 CD2 LEU A 753 19.987 16.848 66.506 1.00 0.00 ATOM 2155 C LEU A 753 22.425 17.898 62.427 1.00 0.00 ATOM 2156 O LEU A 753 23.505 18.500 62.473 1.00 0.00 ATOM 2157 N ALA A 754 22.143 17.013 61.485 1.00 0.00 ATOM 2159 CA ALA A 754 23.21316.380 60.719 1.00 0.00 ATOM 2160 CB ALA A 754 22.696 15.058 60.163 1.00 0.00 ATOM 2161 C ALA A 754 23.677 17.276 59.578 1.00 0.00 ATOM 2162 O ALA A 754 24.878 17.302 59.286 1.00 0.00 ATOM 2163 N GLU A 755 22.814 18.182 59.145 1.00 0.00 ATOM 2165 CA GLUA 755 23.193 19.116 58.085 1.00 0.00 ATOM 2166 CB GLU A 755 21.960 19.852 57.575 1.00 0.00 ATOM 2167 CG GLU A 755 21.023 18.913 56.829 1.00 0.00 ATOM 2168 CD GLU A 755 19.798 19.674 56.332 1.00 0.00 ATOM 2169 OE1 GLU A 755 18.961 20.000 57.165 1.00 0.00ATOM 2170 OE2 GLU A 755 19.799 20.053 55.169 1.00 0.00 ATOM 2171 C GLU A 755 24.214 20.130 58.576 1.00 0.00 ATOM 2172 O GLU A 755 25.291 20.222 57.973 1.00 0.00 ATOM 2173 N ILE A 756 24.028 20.653 59.779 1.00 0.00 ATOM 2175 CA ILE A 756 24.983 21.65460.260 1.00 0.00 ATOM 2176 CB ILE A 756 24.322 22.545 61.318 1.00 0.00 ATOM 2177 CG2 ILE A 756 23.817 21.752 62.519 1.00 0.00 ATOM 2178 CG1 ILE A 756 25.268 23.650 61.779 1.00 0.00 ATOM 2179 CD1 ILE A 756 25.661 24.571 60.627 1.00 0.00 ATOM 2180 C ILE A756 26.272 21.011 60.780 1.00 0.00 ATOM 2181 O ILE A 756 27.349 21.570 60.541 1.00 0.00 ATOM 2182 N ILE A 757 26.217 19.749 61.176 1.00 0.00 ATOM 2184 CA ILE A 757 27.444 19.091 61.625 1.00 0.00 ATOM 2185 CB ILE A 757 27.065 17.921 62.521 1.00 0.00 ATOM2186 CG2 ILE A 757 28.286 17.096 62.897 1.00 0.00 ATOM 2187 CG1 ILE A 757 26.378 18.436 63.778 1.00 0.00 ATOM 2188 CD1 ILE A 757 25.992 17.291 64.706 1.00 0.00 ATOM 2189 C ILE A 757 28.295 18.633 60.441 1.00 0.00 ATOM 2190 O ILE A 757 29.513 18.86260.459 1.00 0.00 ATOM 2191 N THR A 758 27.641 18.331 59.328 1.00 0.00 ATOM 2193 CA THR A 758 28.359 17.931 58.112 1.00 0.00 ATOM 2194 CB THR A 758 27.449 17.028 57.282 1.00 0.00 ATOM 2195 OG1 THR A 758 27.057 15.934 58.101 1.00 0.00 ATOM 2196 CG2 THR A758 28.160 16.456 56.060 1.00 0.00 ATOM 2197 C THR A 758 28.812 19.148 57.299 1.00 0.00 ATOM 2198 O THR A 758 29.766 19.061 56.517 1.00 0.00 ATOM 2199 N ASN A 759 28.256 20.302 57.631 1.00 0.00 ATOM 2201 CA ASN A 759 28.694 21.564 57.032 1.00 0.00 ATOM2202 CB ASN A 759 27.521 22.538 57.142 1.00 0.00 ATOM 2203 CG ASN A 759 27.446 23.525 55.975 1.00 0.00 ATOM 2204 OD1 ASN A 759 26.357 23.772 55.443 1.00 0.00 ATOM 2205 ND2 ASN A 759 28.582 24.076 55.582 1.00 0.00 ATOM 2208 C ASN A 759 29.900 22.12057.796 1.00 0.00 ATOM 2209 O ASN A 759 30.681 22.906 57.241 1.00 0.00 ATOM 2210 N GLN A 760 30.106 21.637 59.008 1.00 0.00 ATOM 2212 CA GLN A 760 31.236 22.099 59.810 1.00 0.00 ATOM 2213 CB GLN A 760 30.869 22.018 61.291 1.00 0.00 ATOM 2214 CG GLN A 76029.783 23.005 61.703 1.00 0.00 ATOM 2215 CD GLN A 760 30.279 24.443 61.609 1.00 0.00 ATOM 2216 OE1 GLN A 760 29.595 25.307 61.051 1.00 0.00 ATOM 2217 NE2 GLN A 760 31.420 24.701 62.228 1.00 0.00 ATOM 2220 C GLN A 760 32.486 21.256 59.594 1.00 0.00 ATOM2221 O GLN A 760 33.313 21.514 58.711 1.00 0.00 ATOM 2222 N ILE A 761 32.583 20.215 60.399 1.00 0.00 ATOM 2224 CA ILE A 761 33.856 19.496 60.557 1.00 0.00 ATOM 2225 CB ILE A 761 33.966 18.975 61.994 1.00 0.00 ATOM 2226 CG2 ILE A 761 33.612 20.082 62.9811.00 0.00 ATOM 2227 CG1 ILE A 761 33.122 17.730 62.279 1.00 0.00 ATOM 2228 CD1 ILE A 761 31.655 18.019 62.571 1.00 0.00 ATOM 2229 C ILE A 761 34.255 18.353 59.592 1.00 0.00 ATOM 2230 O ILE A 761 35.470 18.128 59.556 1.00 0.00 ATOM 2231 N PRO A 762 33.42317.684 58.786 1.00 0.00 ATOM 2232 CA PRO A 762 33.990 16.587 57.981 1.00 0.00 ATOM 2233 CB PRO A 762 32.826 15.811 57.454 1.00 0.00 ATOM 2234 CG PRO A 762 31.549 16.541 57.811 1.00 0.00 ATOM 2235 CD PRO A 762 31.969 17.768 58.599 1.00 0.00 ATOM 2236 CPRO A 762 34.895 17.045 56.832 1.00 0.00 ATOM 2237 O PRO A 762 35.794 16.284 56.452 1.00 0.00 ATOM 2238 N LYS A 763 34.858 18.322 56.481 1.00 0.00 ATOM 2240 CA LYS A 763 35.800 18.836 55.488 1.00 0.00 ATOM 2241 CB LYS A 763 35.284 20.178 54.987 1.00 0.00ATOM 2242 CG LYS A 763 36.216 20.769 53.937 1.00 0.00 ATOM 2243 CD LYS A 763 35.715 22.129 53.471 1.00 0.00 ATOM 2244 CE LYS A 763 35.608 23.099 54.641 1.00 0.00 ATOM 2245 NZ LYS A 763 35.122 24.413 54.193 1.00 0.00 ATOM 2246 C LYS A 763 37.186 19.01756.108 1.00 0.00 ATOM 2247 O LYS A 763 38.180 18.599 55.500 1.00 0.00 ATOM 2248 N TYR A 764 37.208 19.290 57.403 1.00 0.00 ATOM 2250 CA TYR A 764 38.473 19.445 58.126 1.00 0.00 ATOM 2251 CB TYR A 764 38.246 20.377 59.309 1.00 0.00 ATOM 2252 CG TYR A 76437.765 21.762 58.892 1.00 0.00 ATOM 2253 CD1 TYR A 764 38.571 22.563 58.091 1.00 0.00 ATOM 2254 CE1 TYR A 764 38.132 23.822 57.703 1.00 0.00 ATOM 2255 CZ TYR A 764 36.887 24.275 58.118 1.00 0.00 ATOM 2256 OH TYR A 764 36.439 25.514 57.714 1.00 0.00 ATOM2257 CE2 TYR A 764 36.081 23.479 58.921 1.00 0.00 ATOM 2258 CD2 TYR A 764 36.521 22.221 59.308 1.00 0.00 ATOM 2259 C TYR A 764 39.005 18.100 58.610 1.00 0.00 ATOM 2260 O TYR A 764 40.201 17.963 58.894 1.00 0.00 ATOM 2261 N SER A 765 38.160 17.085 58.5831.00 0.00 ATOM 2263 CA SER A 765 38.642 15.731 58.841 1.00 0.00 ATOM 2264 CB SER A 765 37.476 14.854 59.262 1.00 0.00 ATOM 2265 OG SER A 765 37.996 13.542 59.423 1.00 0.00 ATOM 2266 C SER A 765 39.243 15.129 57.583 1.00 0.00 ATOM 2267 O SER A 765 40.32214.528 57.647 1.00 0.00 ATOM 2268 N ASN A 766 38.692 15.522 56.446 1.00 0.00 ATOM 2270 CA ASN A 766 39.144 15.001 55.156 1.00 0.00 ATOM 2271 CB ASN A 766 37.997 15.175 54.170 1.00 0.00 ATOM 2272 CG ASN A 766 37.991 14.009 53.192 1.00 0.00 ATOM 2273 OD1ASN A 766 38.705 13.017 53.392 1.00 0.00 ATOM 2274 ND2 ASN A 766 37.139 14.107 52.187 1.00 0.00 ATOM 2277 C ASN A 766 40.386 15.734 54.649 1.00 0.00 ATOM 2278 O ASN A 766 41.107 15.219 53.788 1.00 0.00 ATOM 2279 N GLY A 767 40.683 16.872 55.256 1.000.00 ATOM 2281 CA GLY A 767 41.940 17.575 54.985 1.00 0.00 ATOM 2282 C GLY A 767 42.836 17.626 56.225 1.00 0.00 ATOM 2283 O GLY A 767 43.666 18.537 56.347 1.00 0.00 ATOM 2284 N ASN A 768 42.705 16.611 57.075 1.00 0.00 ATOM 2286 CA ASN A 768 43.451 16.44758.347 1.00 0.00 ATOM 2287 CB ASN A 768 44.624 15.474 58.159 1.00 0.00 ATOM 2288 CG ASN A 768 45.422 15.672 56.865 1.00 0.00 ATOM 2289 OD1 ASN A 768 45.237 14.929 55.895 1.00 0.00 ATOM 2290 ND2 ASN A 768 46.277 16.679 56.856 1.00 0.00 ATOM 2293 C ASN A768 43.890 17.736 59.057 1.00 0.00 ATOM 2294 O ASN A 768 45.074 18.098 59.107 1.00 0.00 ATOM 2295 N ILE A 769 42.901 18.422 59.604 1.00 0.00 ATOM 2297 CA ILE A 769 43.129 19.606 60.441 1.00 0.00 ATOM 2298 CB ILE A 769 42.150 20.697 59.998 1.00 0.00 ATOM2299 CG2 ILE A 769 42.373 21.997 60.764 1.00 0.00 ATOM 2300 CG1 ILE A 769 42.273 20.969 58.501 1.00 0.00

ATOM 2301 CD1 ILE A 769 43.632 21.569 58.146 1.00 0.00 ATOM 2302 C ILE A 769 42.904 19.214 61.905 1.00 0.00 ATOM 2303 O ILE A 769 43.157 19.978 62.848 1.00 0.00 ATOM 2304 N LYS A 770 42.384 18.009 62.067 1.00 0.00 ATOM 2306 CA LYS A 770 42.19717.426 63.396 1.00 0.00 ATOM 2307 CB LYS A 770 40.980 16.514 63.367 1.00 0.00 ATOM 2308 CG LYS A 770 39.732 17.226 62.870 1.00 0.00 ATOM 2309 CD LYS A 770 38.559 16.256 62.860 1.00 0.00 ATOM 2310 CE LYS A 770 37.295 16.905 62.317 1.00 0.00 ATOM 2311 NZLYS A 770 36.176 15.951 62.360 1.00 0.00 ATOM 2312 C LYS A 770 43.402 16.583 63.790 1.00 0.00 ATOM 2313 O LYS A 770 43.904 15.779 62.995 1.00 0.00 ATOM 2314 N LYS A 771 43.789 16.704 65.044 1.00 0.00 ATOM 2316 CA LYS A 771 44.871 15.890 65.589 1.00 0.00ATOM 2317 CB LYS A 771 45.718 16.747 66.522 1.00 0.00 ATOM 2318 CG LYS A 771 46.919 15.970 67.046 1.00 0.00 ATOM 2319 CD LYS A 771 47.746 16.808 68.012 1.00 0.00 ATOM 2320 CE LYS A 771 48.978 16.044 68.482 1.00 0.00 ATOM 2321 NZ LYS A 771 48.595 14.77369.117 1.00 0.00 ATOM 2322 C LYS A 771 44.279 14.701 66.341 1.00 0.00 ATOM 2323 O LYS A 771 43.718 14.839 67.439 1.00 0.00 ATOM 2324 N LEU A 772 44.328 13.556 65.681 1.00 0.00 ATOM 2326 CA LEU A 772 43.820 12.312 66.269 1.00 0.00 ATOM 2327 CB LEU A 77243.750 11.239 65.190 1.00 0.00 ATOM 2328 CG LEU A 772 42.857 11.660 64.027 1.00 0.00 ATOM 2329 CD1 LEU A 772 42.936 10.647 62.891 1.00 0.00 ATOM 2330 CD2 LEU A 772 41.412 11.858 64.474 1.00 0.00 ATOM 2331 C LEU A 772 44.735 11.847 67.392 1.00 0.00 ATOM2332 O LEU A 772 45.962 11.777 67.243 1.00 0.00 ATOM 2333 N LEU A 773 44.121 11.518 68.511 1.00 0.00 ATOM 2335 CA LEU A 773 44.879 11.136 69.702 1.00 0.00 ATOM 2336 CB LEU A 773 44.153 11.686 70.918 1.00 0.00 ATOM 2337 CG LEU A 773 44.107 13.209 70.8741.00 0.00 ATOM 2338 CD1 LEU A 773 43.185 13.758 71.949 1.00 0.00 ATOM 2339 CD2 LEU A 773 45.502 13.813 71.000 1.00 0.00 ATOM 2340 C LEU A 773 45.049 9.627 69.811 1.00 0.00 ATOM 2341 O LEU A 773 44.270 8.925 70.468 1.00 0.00 ATOM 2342 N PHE A 774 46.1029.152 69.171 1.00 0.00 ATOM 2344 CA PHE A 774 46.446 7.730 69.206 1.00 0.00 ATOM 2345 CB PHE A 774 47.402 7.415 68.061 1.00 0.00 ATOM 2346 CG PHE A 774 46.818 7.588 66.661 1.00 0.00 ATOM 2347 CD1 PHE A 774 46.000 6.601 66.129 1.00 0.00 ATOM 2348 CE1 PHEA 774 45.469 6.750 64.855 1.00 0.00 ATOM 2349 CZ PHE A 774 45.756 7.886 64.111 1.00 0.00 ATOM 2350 CE2 PHE A 774 46.580 8.872 64.639 1.00 0.00 ATOM 2351 CD2 PHE A 774 47.113 8.722 65.913 1.00 0.00 ATOM 2352 C PHE A 774 47.098 7.359 70.533 1.00 0.00 ATOM2353 O PHE A 774 47.703 8.196 71.214 1.00 0.00 ATOM 2354 N HIS A 775 46.872 6.123 70.935 1.00 0.00 ATOM 2356 CA HIS A 775 47.477 5.606 72.164 1.00 0.00 ATOM 2357 CB HIS A 775 46.495 4.641 72.813 1.00 0.00 ATOM 2358 CG HIS A 775 45.110 5.223 73.015 1.000.00 ATOM 2359 ND1 HIS A 775 44.779 6.249 73.822 1.00 0.00 ATOM 2361 CE1 HIS A 775 43.452 6.474 73.733 1.00 0.00 ATOM 2362 NE2 HIS A 775 42.943 5.584 72.852 1.00 0.00 ATOM 2363 CD2 HIS A 775 43.953 4.808 72.399 1.00 0.00 ATOM 2364 C HIS A 775 48.7834.881 71.850 1.00 0.00 ATOM 2365 O HIS A 775 49.606 4.626 72.738 1.00 0.00 ATOM 2366 N GLN A 776 48.938 4.524 70.587 1.00 0.00 ATOM 2368 CA GLN A 776 50.184 3.948 70.082 1.00 0.00 ATOM 2369 CB GLN A 776 49.907 2.620 69.368 1.00 0.00 ATOM 2370 CG GLN A776 49.722 1.423 70.301 1.00 0.00 ATOM 2371 CD GLN A 776 48.349 1.388 70.971 1.00 0.00 ATOM 2372 OE1 GLN A 776 47.317 1.635 70.338 1.00 0.00 ATOM 2373 NE2 GLN A 776 48.366 1.169 72.273 1.00 0.00 ATOM 2376 C GLN A 776 50.844 4.920 69.109 1.00 0.00 ATOM2377 O GLN A 776 50.191 5.805 68.543 1.00 0.00 ATOM 2378 N LYS A 777 52.144 4.759 68.938 1.00 0.00 ATOM 2380 CA LYS A 777 52.889 5.591 67.988 1.00 0.00 ATOM 2381 CB LYS A 777 54.380 5.448 68.265 1.00 0.00 ATOM 2382 CG LYS A 777 55.198 6.329 67.324 1.000.00 ATOM 2383 CD LYS A 777 56.692 6.164 67.572 1.00 0.00 ATOM 2384 CE LYS A 777 57.512 7.038 66.629 1.00 0.00 ATOM 2385 NZ LYS A 777 58.955 6.873 66.868 1.00 0.00 ATOM 2386 C LYS A 777 52.585 5.164 66.560 1.00 0.00 ATOM 2387 O LYS A 777 51.832 5.87565.904 1.00 0.00 ATOM 2388 OXT LYS A 777 53.080 4.119 66.149 1.00 0.00

Example 22

Structure Coordinates of Site II in Various NHRs, Table III

Below is Table III, which gives the structure coordinates for Site II in various NHRs based on the consensus alignments in FIG. 2. The format used is based on that commonly used in the RCSB (Research Collaboratory for Structural Bioinformatics,pdb file format), and the fields listed from left to right are defined as follows: record name, atom serial number, atom name, residue name, chain identifier, residue sequence number, orthogonal coordinate for x in .ANG.ngstroms, orthogonal cordinate fory in .ANG.ngstroms, orthogonal coordinate for z in .ANG.ngstroms, occupancy, and temperature factor.

TABLE-US-00008 TABLE III Structure Coordinates for Site II in Various NHRs Based on the Consensus Alignments in FIG.2 AR Site II Residues (ref. 1E3G.pdb) (highlighted residues of SEQ ID NO:6) ATOM 73 N GLU A 678 9.927 12.170 14.764 1.00 34.27ATOM 74 CA GLU A 678 9.788 11.576 13.433 1.00 33.68 ATOM 75 C GLU A 678 8.502 10.791 13.361 1.00 31.24 ATOM 76 O GLU A 678 7.837 10.730 12.318 1.00 29.04 ATOM 77 CB GLU A 678 10.972 10.692 13.139 1.00 41.54 ATOM 78 CG GLU A 678 12.250 11.475 13.231 1.0062.50 ATOM 79 CD GLU A 678 13.492 10.632 13.140 1.00 75.90 ATOM 80 OE1 GLU A 678 13.382 9.393 13.275 1.00 81.73 ATOM 81 OE2 GLU A 678 14.581 11.222 12.946 1.00 77.79 ATOM 82 N ALA A 679 8.118 10.229 14.496 1.00 27.29 ATOM 83 CA ALA A 679 6.878 9.48614.561 1.00 31.51 ATOM 84 C ALA A 679 5.658 10.400 14.416 1.00 37.88 ATOM 85 O ALA A 679 4.657 10.013 13.784 1.00 39.80 ATOM 86 CB ALA A 679 6.807 8.699 15.862 1.00 32.16 ATOM 87 N ILE A 680 5.748 11.621 14.958 1.00 36.75 ATOM 88 CA ILE A 680 4.62312.567 14.893 1.00 33.51 ATOM 89 C ILE A 680 4.603 13.553 13.732 1.00 29.78 ATOM 90 O ILE A 680 3.560 14.137 13.425 1.00 35.01 ATOM 91 CB ILE A 680 4.445 13.322 16.204 1.00 36.86 ATOM 92 CG1 ILE A 680 5.672 14.178 16.493 1.00 39.01 ATOM 93 CG2 ILE A 6804.222 12.324 17.343 1.00 34.87 ATOM 94 CD1 ILE A 680 5.503 15.046 17.719 1.00 38.54 ATOM 95 N GLU A 681 5.732 13.677 13.044 1.00 31.29 ATOM 96 CA GLU A 681 5.833 14.570 11.904 1.00 36.50 ATOM 97 C GLU A 681 4.638 14.373 11.013 1.00 38.74 ATOM 98 O GLU A681 4.348 13.251 10.596 1.00 46.06 ATOM 99 CB GLU A 681 7.101 14.285 11.106 1.00 33.49 ATOM 100 CG GLU A 681 7.361 15.322 10.028 1.00 41.42 ATOM 101 CD GLU A 681 7.500 16.742 10.581 1.00 49.46 ATOM 102 OE1 GLU A 681 7.569 16.924 11.824 1.00 44.22 ATOM103 OE2 GLU A 681 7.527 17.687 9.759 1.00 52.12 ATOM 104 N PRO A 682 3.892 15.446 10.751 1.00 41.06 ATOM 105 CA PRO A 682 2.695 15.422 9.904 1.00 41.12 ATOM 106 C PRO A 682 2.968 14.980 8.444 1.00 44.28 ATOM 107 O PRO A 682 4.076 15.133 7.920 1.00 36.92ATOM 108 CB PRO A 682 2.214 16.870 9.965 1.00 43.30 ATOM 109 CG PRO A 682 2.800 17.399 11.250 1.00 38.89 ATOM 110 CD PRO A 682 4.159 16.800 11.261 1.00 39.59 ATOM 111 N GLY A 683 1.943 14.446 7.788 1.00 48.21 ATOM 112 CA GLY A 683 2.103 13.990 6.416 1.0051.13 ATOM 113 C GLY A 683 1.905 15.043 5.334 1.00 54.68 ATOM 114 O GLY A 683 1.817 16.226 5.629 1.00 63.53 ATOM 115 N VAL A 684 1.729 14.601 4.089 1.00 57.20 ATOM 116 CA VAL A 684 1.544 15.505 2.959 1.00 54.91 ATOM 117 C VAL A 684 0.123 16.048 2.9521.00 54.45 ATOM 118 O VAL A 684 -0.828 15.287 2.775 1.00 57.51 ATOM 119 CB VAL A 684 1.805 14.792 1.625 1.00 51.72 ATOM 120 CG1 VAL A 684 1.618 15.769 0.487 1.00 53.17 ATOM 121 CG2 VAL A 684 3.222 14.212 1.591 1.00 53.92 ATOM 282 N LEU A 707 -5.30726.167 2.636 1.00 38.31 ATOM 283 CA LEU A 707 -4.152 25.342 2.982 1.00 37.96 ATOM 284 C LEU A 707 -3.767 25.654 4.431 1.00 44.27 ATOM 285 O LEU A 707 -3.464 24.747 5.211 1.00 51.41 ATOM 286 CB LEU A 707 -2.958 25.608 2.046 1.00 35.41 ATOM 287 CG LEU A707 -1.651 24.872 2.392 1.00 35.71 ATOM 288 CD1 LEU A 707 -1.895 23.385 2.326 1.00 38.82 ATOM 289 CD2 LEU A 707 -0.518 25.239 1.459 1.00 33.25 ATOM 290 N GLY A 708 -3.782 26.938 4.787 1.00 45.88 ATOM 291 CA GLY A 708 -3.463 27.344 6.144 1.00 40.92 ATOM292 C GLY A 708 -4.386 26.618 7.096 1.00 39.05 ATOM 293 O GLY A 708 -3.937 25.851 7.924 1.00 45.81 ATOM 314 N GLN A 711 -3.596 22.939 7.556 1.00 40.11 ATOM 315 CA GLN A 711 -2.310 22.685 8.189 1.00 34.69 ATOM 316 C GLN A 711 -2.355 23.007 9.653 1.0036.60 ATOM 317 O GLN A 711 -1.501 22.557 10.408 1.00 40.79 ATOM 318 CB GLN A 711 -1.194 23.478 7.542 1.00 42.15 ATOM 319 CG GLN A 711 -0.753 22.877 6.244 1.00 43.03 ATOM 320 CD GLN A 711 0.553 23.442 5.779 1.00 44.24 ATOM 321 OE1 GLN A 711 1.321 23.9886.567 1.00 54.32 ATOM 322 NE2 GLN A 711 0.828 23.305 4.496 1.00 52.33 ATOM 323 N LEU A 712 -3.361 23.778 10.054 1.00 41.25 ATOM 324 CA LEU A 712 -3.561 24.163 11.457 1.00 43.47 ATOM 325 C LEU A 712 -4.061 22.938 12.222 1.00 45.20 ATOM 326 O LEU A 712-3.595 22.628 13.320 1.00 46.51 ATOM 327 CB LEU A 712 -4.585 25.295 11.550 1.00 42.08 ATOM 328 CG LEU A 712 -4.829 25.943 12.905 1.00 45.04 ATOM 329 CD1 LEU A 712 -3.489 26.199 13.594 1.00 48.18 ATOM 330 CD2 LEU A 712 -5.610 27.248 12.711 1.00 44.32 ATOM331 N VAL A 713 -5.014 22.240 11.623 1.00 42.76 ATOM 332 CA VAL A 713 -5.555 21.026 12.198 1.00 41.99 ATOM 333 C VAL A 713 -4.383 20.100 12.562 1.00 45.10 ATOM 334 O VAL A 713 -4.275 19.646 13.703 1.00 45.64 ATOM 335 CB VAL A 713 -6.480 20.348 11.1701.00 43.85 ATOM 336 CG1 VAL A 713 -6.887 18.953 11.628 1.00 52.59 ATOM 337 CG2 VAL A 713 -7.708 21.203 10.966 1.00 42.38 ATOM 338 N HIS A 714 -3.471 19.905 11.604 1.00 46.35 ATOM 339 CA HIS A 714 -2.286 19.044 11.767 1.00 45.95 ATOM 340 C HIS A 714-1.379 19.495 12.857 1.00 43.82 ATOM 341 O HIS A 714 -0.798 18.674 13.571 1.00 48.61 ATOM 342 CB HIS A 714 -1.458 18.971 10.487 1.00 49.61 ATOM 343 CG HIS A 714 -1.950 17.947 9.519 1.00 62.09 ATOM 344 ND1 HIS A 714 -3.157 18.058 8.873 1.00 63.02 ATOM345 CD2 HIS A 714 -1.404 16.778 9.108 1.00 64.82 ATOM 346 CE1 HIS A 714 -3.340 17.005 8.100 1.00 70.96 ATOM 347 NE2 HIS A 714 -2.291 16.211 8.219 1.00 70.54 ATOM 348 N VAL A 715 -1.172 20.803 12.898 1.00 40.29 ATOM 349 CA VAL A 715 -0.326 21.415 13.9081.00 39.63 ATOM 350 C VAL A 715 -0.962 21.201 15.273 1.00 36.62 ATOM 351 O VAL A 715 -0.266 20.874 16.244 1.00 30.18 ATOM 352 CB VAL A 715 -0.101 22.918 13.620 1.00 38.77 ATOM 353 CG1 VAL A 715 0.500 23.617 14.820 1.00 30.17 ATOM 354 CG2 VAL A 715 0.85723.048 12.463 1.00 40.69 ATOM 355 N VAL A 716 -2.286 21.329 15.331 1.00 28.64 ATOM 356 CA VAL A 716 -2.994 21.113 16.570 1.00 28.84 ATOM 357 C VAL A 716 -2.687 19.683 17.037 1.00 36.83 ATOM 358 O VAL A 716 -2.078 19.485 18.092 1.00 36.70 ATOM 359 CB VALA 716 -4.508 21.331 16.403 1.00 34.61 ATOM 360 CG1 VAL A 716 -5.239 20.839 17.647 1.00 29.84 ATOM 361 CG2 VAL A 716 -4.805 22.811 16.185 1.00 32.32 ATOM 362 N LYS A 717 -2.972 18.709 16.179 1.00 38.71 ATOM 363 CA LYS A 717 -2.737 17.313 16.505 1.00 32.14ATOM 364 C LYS A 717 -1.263 16.990 16.699 1.00 32.82 ATOM 365 O LYS A 717 -0.920 16.262 17.631 1.00 34.86 ATOM 366 CB LYS A 717 -3.370 16.410 15.450 1.00 32.30 ATOM 367 CG LYS A 717 -4.890 16.352 15.569 1.00 38.88 ATOM 368 CD LYS A 717 -5.538 15.58414.436 1.00 36.05 ATOM 369 CE LYS A 717 -7.009 15.353 14.736 1.00 36.14 ATOM 370 NZ LYS A 717 -7.739 14.704 13.619 1.00 35.32 ATOM 371 N TRP A 718 -0.383 17.589 15.893 1.00 31.69 ATOM 372 CA TRP A 718 1.058 17.319 16.010 1.00 34.84 ATOM 373 C TRP A 7181.604 17.753 17.367 1.00 44.15 ATOM 374 O TRP A 718 2.347 17.014 18.020 1.00 48.94 ATOM 375 CB TRP A 718 1.850 17.995 14.883 1.00 25.87 ATOM 376 CG TRP A 718 3.343 18.092 15.136 1.00 25.59 ATOM 377 CD1 TRP A 718 4.279 17.133 14.909 1.00 35.87 ATOM 378CD2 TRP A 718 4.055 19.232 15.641 1.00 30.45 ATOM 379 NE1 TRP A 718 5.533 17.598 15.237 1.00 32.13 ATOM 380 CE2 TRP A 718 5.419 18.889 15.689 1.00 30.51 ATOM 381 CE3 TRP A 718 3.672 20.519 16.046 1.00 32.20 ATOM 382 CZ2 TRP A 718 6.403 19.782 16.119 1.0032.90 ATOM 383 CZ3 TRP A 718 4.650 21.408 16.468 1.00 25.41 ATOM 384 CH2 TRP A 718 5.997 21.036 16.503 1.00 28.69 ATOM 552 N SER A 740 2.351 30.606 17.674 1.00 36.52 ATOM 553 CA SER A 740 3.459 30.114 16.875 1.00 38.17 ATOM 554 C SER A 740 3.129 29.45315.535 1.00 38.14 ATOM 555 O SER A 740 4.024 29.259 14.706 1.00 41.67 ATOM 556 CB SER A 740 4.390 29.231 17.727 1.00 42.37 ATOM 557 OG SER A 740 3.756 28.053 18.200 1.00 39.05 ATOM 558 N TRP A 741 1.851 29.268 15.236 1.00 32.00 ATOM 559 CA TRP A 7411.482 28.588 14.004 1.00 32.79 ATOM 560 C TRP A 741 2.099 29.060 12.681 1.00 34.24 ATOM 561 O TRP A 741 2.578 28.250 11.891 1.00 34.43 ATOM 562 CB TRP A 741 -0.034 28.446 13.918 1.00 44.21 ATOM 563 CG TRP A 741 -0.733 29.487 13.136 1.00 58.12 ATOM 564CD1 TRP A 741 -0.889 30.806 13.458 1.00 64.16 ATOM 565 CD2 TRP A 741 -1.365 29.303 11.870 1.00 63.13 ATOM 566 NE1 TRP A 741 -1.574 31.462 12.462 1.00 67.31 ATOM 567 CE2 TRP A 741 -1.882 30.562 11.473 1.00 67.95 ATOM 568 CE3 TRP A 741 -1.558 28.194 11.0311.00 57.71 ATOM 569 CZ2 TRP A 741 -2.561 30.747 10.260 1.00 70.02 ATOM 570 CZ3 TRP A 741 -2.232 28.373 9.831 1.00 59.16 ATOM 571 CH2 TRP A 741 -2.731 29.642 9.458 1.00 65.30 ATOM 572 N MET A 742 2.184 30.370 12.489 1.00 41.58 ATOM 573 CA MET A 742 2.74930.945 11.265 1.00 39.13 ATOM 574 C MET A 742 4.193 30.537 11.090 1.00 30.85 ATOM 575 O MET A 742 4.602 30.115 10.017 1.00 34.78 ATOM 576 CB MET A 742 2.689 32.476 11.309 1.00 42.39 ATOM 577 CG MET A 742 3.147 33.177 10.032 1.00 43.70 ATOM 578 SD MET A742 1.988 32.993 8.658 1.00 45.17 ATOM 579 CE MET A 742 0.678 34.132 9.133 1.00 22.14 ATOM 580 N GLY A 743 4.954 30.648 12.165 1.00 24.94 ATOM 581 CA GLY A 743 6.367 30.312 12.117 1.00 27.24 ATOM 582 C GLY A 743 6.630 28.836 11.886 1.00 27.21 ATOM 583 OGLY A 743 7.660 28.461 11.322 1.00 27.69 ATOM 584 N LEU A 744 5.734 27.983 12.372 1.00 25.91 ATOM 585 CA LEU A 744 5.895 26.550 12.172 1.00 26.90 ATOM 586 C LEU A 744 5.632 26.287 10.708 1.00 27.04 ATOM 587 O LEU A 744 6.375 25.574 10.048 1.00 31.01 ATOM588 CB LEU A 744 4.899 25.755 13.018 1.00 25.72 ATOM 589 CG LEU A 744 5.234 25.626 14.514 1.00 29.11 ATOM 590 CD1 LEU A 744 4.063 25.022 15.275 1.00 23.25 ATOM 591 CD2 LEU A 744 6.484 24.771 14.689 1.00 24.15 ATOM 592 N MET A 745 4.566 26.886 10.200 1.0025.67 ATOM 593 CA MET A 745 4.188 26.725 8.803 1.00 23.96 ATOM 594 C MET A 745 5.254 27.179 7.822 1.00 29.61 ATOM 595 O MET A 745 5.550 26.480 6.857 1.00 34.60 ATOM 596 CB MET A 745 2.895 27.454 8.534 1.00 20.46 ATOM 597 CG MET A 745 1.730 26.888 9.3101.00 19.98 ATOM 598 SD MET A 745 0.297 27.272 8.341 1.00 43.15 ATOM 599 CE MET A 745 0.642 29.041 8.042 1.00 44.27 ATOM 600 N VAL A 746 5.830 28.341 8.095 1.00 27.98 ATOM 601 CA VAL A 746 6.876 28.924 7.288 1.00 24.84 ATOM 602 C VAL A 746 8.107 28.0517.345 1.00 28.42 ATOM 603 O VAL A 746 8.749 27.786 6.333 1.00 37.05 ATOM 604 CB VAL A 746 7.248 30.304 7.835 1.00 31.98 ATOM 605 CG1 VAL A 746 8.423 30.888 7.073 1.00 29.03 ATOM 606 CG2 VAL A 746 6.066 31.196 7.737 1.00 32.19 ATOM 607 N PHE A 747 8.43927.607 8.541 1.00 31.29 ATOM 608 CA PHE A 747 9.605 26.765 8.736 1.00 32.19 ATOM 609 C PHE A 747 9.468 25.401 8.030 1.00 35.99 ATOM 610 O PHE A 747 10.398 24.916 7.384 1.00 34.95 ATOM 611 CB PHE A 747 9.820 26.536 10.224 1.00 27.90 ATOM 612 CG PHE A 74711.209 26.082 10.573 1.00 26.00 ATOM 613 CD1 PHE A 747 12.293 26.915 10.343 1.00 24.54 ATOM 614 CD2 PHE A 747 11.428 24.846 11.166 1.00 27.23 ATOM 615 CE1 PHE A 747 13.571 26.532 10.699 1.00 25.88 ATOM 616 CE2 PHE A 747 12.711 24.451 11.528 1.00 25.61ATOM 617 CZ PHE A 747 13.785 25.297 11.293 1.00 28.75 ATOM 618 N ALA A 748 8.309 24.774 8.171 1.00 35.11 ATOM 619 CA ALA A 748 8.096 23.483 7.561 1.00 34.00 ATOM 620 C ALA A 748 8.114 23.683 6.054 1.00 37.26 ATOM 621 O ALA A 748 8.831 22.973 5.344 1.0035.87 ATOM 622 CB ALA A 748 6.773 22.896 8.022 1.00 29.48 ATOM 635 N TRP A 751 11.304 23.876 4.581 1.00 45.43 ATOM 636 CA TRP A 751 11.976 22.588 4.528 1.00 42.53 ATOM 637 C TRP A 751 11.519 21.806 3.294 1.00 43.17 ATOM 638 O TRP A 751 12.336 21.2072.596 1.00 40.24 ATOM 639 CB TRP A 751 11.717 21.776 5.787 1.00 39.21 ATOM 640 CG TRP A 751 12.359 20.401 5.737 1.00 41.85 ATOM 641 CD1 TRP A 751 11.736 19.213 5.461 1.00 39.44 ATOM 642 CD2 TRP A 751 13.743 20.085 5.968 1.00 37.37 ATOM 643 NE1 TRP A 75112.645 18.186 5.516 1.00 42.23 ATOM 644 CE2 TRP A 751 13.878 18.692 5.821 1.00 41.26 ATOM 645 CE3 TRP A 751 14.877 20.841 6.275 1.00 41.35 ATOM 646 CZ2 TRP A 751 15.110 18.046 5.978 1.00 48.39 ATOM 647 CZ3 TRP A 751 16.104 20.195 6.431 1.00 39.62 ATOM648 CH2 TRP A 751 16.208 18.817 6.280 1.00 43.38 ATOM 649 N ARG A 752 10.214 21.792 3.037 1.00 42.27 ATOM 650 CA ARG A 752 9.683 21.100 1.862 1.00 41.53 ATOM 651 C ARG A 752 10.257 21.740 0.602 1.00 44.18 ATOM 652 O ARG A 752 10.522 21.048 -0.380 1.0043.20 ATOM 653 CB ARG A 752 8.163 21.186 1.800 1.00 42.14 ATOM 654 CG ARG A 752 7.441 20.465 2.920 1.00 49.76 ATOM 655 CD ARG A 752 5.938 20.434 2.649 1.00 48.23 ATOM 656 NE ARG A 752 5.382 21.773 2.483 1.00 45.23 ATOM 657 CZ ARG A 752 5.013 22.572 3.4901.00 52.17 ATOM 658 NH1 ARG A 752 5.131 22.175 4.764 1.00 33.80 ATOM 659 NH2 ARG A 752 4.536 23.785 3.223 1.00 49.84 ATOM 677 N THR A 755 13.948 20.208 0.225 1.00 53.24 ATOM 678 CA THR A 755 14.053 18.818 -0.197 1.00 53.33 ATOM 679 C THR A 755 13.28718.474 -1.478 1.00 54.87 ATOM 680 O THR A 755 13.554 17.431 -2.068 1.00 57.41 ATOM 681 CB THR A 755 13.596 17.830 0.934 1.00 45.98 ATOM 682 OG1 THR A 755 12.221 18.055 1.245 1.00 49.35 ATOM 683 CG2 THR A 755 14.405 18.033 2.190 1.00 40.03 ATOM 684 N ASNA 756 12.360 19.336 -1.911 1.00 52.97 ATOM 685 CA ASN A 756 11.539 19.044 -3.097 1.00 56.15 ATOM 686 C ASN A 756 11.821 19.826 -4.394 1.00 55.33 ATOM 687 O ASN A 756 11.705 19.257 -5.481 1.00 54.81 ATOM 688 CB ASN A 756 10.019 19.124 -2.769 1.00 60.43ATOM 689 CG ASN A 756 9.504 17.959 -1.869 1.00 57.82 ATOM 690 OD1 ASN A 756 10.123 16.909 -1.763 1.00 55.71 ATOM 691 ND2 ASN A 756 8.354 18.169 -1.234 1.00 56.46 ATOM 768 N PRO A 766 1.766 20.021 -2.533 1.00 52.86

ATOM 769 CA PRO A 766 2.120 19.407 -3.813 1.00 50.96 ATOM 770 C PRO A 766 1.359 20.040 -4.970 1.00 48.25 ATOM 771 O PRO A 766 1.893 20.144 -6.082 1.00 44.31 ATOM 772 CB PRO A 766 1.721 17.949 -3.604 1.00 57.00 ATOM 773 CG PRO A 766 1.899 17.761-2.133 1.00 58.08 ATOM 774 CD PRO A 766 1.237 19.002 -1.617 1.00 57.23 ATOM 1099 N PHE A 804 16.541 19.584 11.932 1.00 32.10 ATOM 1100 CA PHE A 804 15.286 20.166 11.519 1.00 26.58 ATOM 1101 C PHE A 804 14.157 19.876 12.497 1.00 29.08 ATOM 1102 O PHE A804 13.528 20.793 13.024 1.00 38.23 ATOM 1103 CB PHE A 804 14.872 19.663 10.142 1.00 24.46 ATOM 1104 CG PHE A 804 13.445 20.032 9.767 1.00 35.13 ATOM 1105 CD1 PHE A 804 13.091 21.361 9.540 1.00 36.25 ATOM 1106 CD2 PHE A 804 12.468 19.048 9.617 1.00 38.14ATOM 1107 CE1 PHE A 804 11.795 21.712 9.164 1.00 27.83 ATOM 1108 CE2 PHE A 804 11.163 19.385 9.238 1.00 39.32 ATOM 1109 CZ PHE A 804 10.826 20.723 9.011 1.00 38.61 ATOM 1110 N LEU A 805 13.887 18.600 12.728 1.00 30.73 ATOM 1111 CA LEU A 805 12.784 18.21513.586 1.00 28.43 ATOM 1112 C LEU A 805 12.880 18.799 14.946 1.00 26.10 ATOM 1113 O LEU A 805 11.881 19.243 15.493 1.00 34.14 ATOM 1114 CB LEU A 805 12.648 16.702 13.661 1.00 34.10 ATOM 1115 CG LEU A 805 12.000 16.079 12.423 1.00 43.20 ATOM 1116 CD1 LEUA 805 12.046 14.617 12.600 1.00 36.94 ATOM 1117 CD2 LEU A 805 10.549 16.523 12.252 1.00 44.97 ATOM 1132 N LYS A 808 12.006 22.545 14.617 1.00 27.59 ATOM 1133 CA LYS A 808 10.597 22.787 14.378 1.00 27.15 ATOM 1134 C LYS A 808 9.841 22.681 15.686 1.0029.83 ATOM 1135 O LYS A 808 8.954 23.486 15.952 1.00 35.67 ATOM 1136 CB LYS A 808 10.029 21.837 13.313 1.00 24.49 ATOM 1137 CG LYS A 808 8.598 22.158 12.811 1.00 23.62 ATOM 1138 CD LYS A 808 8.148 21.143 11.740 1.00 24.64 ATOM 1139 CE LYS A 808 7.15720.101 12.280 1.00 29.39 ATOM 1140 NZ LYS A 808 5.683 20.529 12.198 1.00 36.92 ERalpha Site II Residues (ref. 1A52.pdb) ATOM 99 N LEU A 320 99.203 35.236 105.992 1.00 52.59 ATOM 100 CA LEU A 320 100.556 35.138 106.514 1.00 52.15 ATOM 101 C LEU A 320100.597 34.433 107.854 1.00 52.92 ATOM 102 O LEU A 320 101.488 33.625 108.100 1.00 53.52 ATOM 103 CB LEU A 320 101.202 36.518 106.612 1.00 51.20 ATOM 104 CG LEU A 320 101.704 37.051 105.270 1.00 50.53 ATOM 105 CD1 LEU A 320 102.077 38.500 105.353 1.0050.26 ATOM 106 CD2 LEU A 320 102.898 36.232 104.860 1.00 51.08 ATOM 107 N ASP A 321 99.629 34.697 108.718 1.00 53.43 ATOM 108 CA ASP A 321 99.645 34.048 110.015 1.00 54.53 ATOM 109 C ASP A 321 99.250 32.587 109.939 1.00 54.61 ATOM 110 O ASP A 321 99.66131.777 110.769 1.00 54.98 ATOM 111 CB ASP A 321 98.731 34.785 110.993 1.00 56.68 ATOM 112 CG ASP A 321 99.259 36.183 111.361 1.00 57.98 ATOM 113 OD1 ASP A 321 100.332 36.589 110.852 1.00 58.21 ATOM 114 OD2 ASP A 321 98.594 36.878 112.165 1.00 59.27 ATOM115 N ALA A 322 98.460 32.240 108.936 1.00 54.13 ATOM 116 CA ALA A 322 98.014 30.865 108.787 1.00 53.35 ATOM 117 C ALA A 322 99.151 29.943 108.300 1.00 52.94 ATOM 118 O ALA A 322 99.020 28.702 108.340 1.00 52.54 ATOM 119 CB ALA A 322 96.825 30.821107.812 1.00 54.16 ATOM 120 N GLU A 323 100.259 30.544 107.850 1.00 52.13 ATOM 121 CA GLU A 323 101.393 29.774 107.338 1.00 51.75 ATOM 122 C GLU A 323 101.839 28.683 108.270 1.00 52.28 ATOM 123 O GLU A 323 102.104 28.912 109.443 1.00 51.95 ATOM 124 CBGLU A 323 102.551 30.690 107.007 1.00 51.77 ATOM 125 CG GLU A 323 102.353 31.385 105.703 1.00 52.53 ATOM 126 CD GLU A 323 102.333 30.394 104.540 1.00 53.56 ATOM 127 OE1 GLU A 323 103.433 29.960 104.114 1.00 54.59 ATOM 128 OE2 GLU A 323 101.227 30.031104.065 1.00 52.74 ATOM 129 N PRO A 324 101.964 27.468 107.743 1.00 53.31 ATOM 130 CA PRO A 324 102.372 26.301 108.525 1.00 54.25 ATOM 131 C PRO A 324 103.845 26.353 108.943 1.00 54.72 ATOM 132 O PRO A 324 104.663 27.053 108.319 1.00 54.54 ATOM 133 CBPRO A 324 102.068 25.147 107.565 1.00 53.80 ATOM 134 CG PRO A 324 102.536 25.776 106.251 1.00 52.98 ATOM 135 CD PRO A 324 101.762 27.082 106.335 1.00 53.61 ATOM 136 N PRO A 325 104.208 25.577 109.983 1.00 55.14 ATOM 137 CA PRO A 325 105.593 25.547110.469 1.00 54.70 ATOM 138 C PRO A 325 106.379 24.848 109.385 1.00 54.48 ATOM 139 O PRO A 325 105.787 24.056 108.642 1.00 55.54 ATOM 140 CB PRO A 325 105.498 24.655 111.705 1.00 54.34 ATOM 141 CG PRO A 325 104.000 24.741 112.096 1.00 55.28 ATOM 142 CDPRO A 325 103.384 24.614 110.742 1.00 55.43 ATOM 143 N ILE A 326 107.669 25.137 109.238 1.00 53.52 ATOM 144 CA ILE A 326 108.431 24.363 108.257 1.00 53.10 ATOM 145 C ILE A 326 108.947 23.151 109.046 1.00 53.30 ATOM 146 O ILE A 326 109.625 23.300 110.0601.00 53.12 ATOM 147 CB ILE A 326 109.607 25.120 107.663 1.00 52.50 ATOM 148 CG1 ILE A 326 109.084 26.335 106.902 1.00 52.50 ATOM 149 CG2 ILE A 326 110.397 24.196 106.754 1.00 50.93 ATOM 150 CD1 ILE A 326 110.123 27.100 106.106 1.00 52.06 ATOM 335 N LEU A349 107.683 12.917 105.119 1.00 58.44 ATOM 336 CA LEU A 349 107.691 14.379 105.202 1.00 56.38 ATOM 337 C LEU A 349 106.356 14.884 104.687 1.00 56.04 ATOM 338 O LEU A 349 105.738 15.751 105.278 1.00 56.02 ATOM 339 CB LEU A 349 108.809 14.943 104.334 1.0055.75 ATOM 340 CG LEU A 349 108.897 16.461 104.251 1.00 55.07 ATOM 341 CD1 LEU A 349 109.007 16.966 105.652 1.00 55.38 ATOM 342 CD2 LEU A 349 110.093 16.927 103.420 1.00 54.73 ATOM 343 N ALA A 350 105.905 14.318 103.577 1.00 55.56 ATOM 344 CA ALA A 350104.634 14.712 103.008 1.00 55.49 ATOM 345 C ALA A 350 103.449 14.347 103.908 1.00 56.16 ATOM 346 O ALA A 350 102.596 15.203 104.190 1.00 56.22 ATOM 347 CB ALA A 350 104.464 14.076 101.649 1.00 55.28 ATOM 367 N GLU A 353 103.417 16.944 106.610 1.00 56.06ATOM 368 CA GLU A 353 103.047 18.295 106.162 1.00 54.56 ATOM 369 C GLU A 353 101.569 18.318 105.901 1.00 54.44 ATOM 370 O GLU A 353 100.910 19.359 106.000 1.00 53.15 ATOM 371 CB GLU A 353 103.727 18.642 104.868 1.00 53.28 ATOM 372 CG GLU A 353 105.10919.058 105.045 1.00 53.60 ATOM 373 CD GLU A 353 105.702 19.417 103.747 1.00 54.14 ATOM 374 OE1 GLU A 353 105.891 18.500 102.923 1.00 53.79 ATOM 375 OE2 GLU A 353 105.955 20.618 103.544 1.00 55.37 ATOM 376 N LEU A 354 101.068 17.136 105.553 1.00 54.59ATOM 377 CA LEU A 354 99.684 16.970 105.247 1.00 55.05 ATOM 378 C LEU A 354 98.899 17.390 106.452 1.00 55.83 ATOM 379 O LEU A 354 98.064 18.289 106.369 1.00 56.40 ATOM 380 CB LEU A 354 99.415 15.525 104.904 1.00 55.25 ATOM 381 CG LEU A 354 98.027 15.235104.327 1.00 55.93 ATOM 382 CD1 LEU A 354 97.723 16.127 103.112 1.00 55.51 ATOM 383 CD2 LEU A 354 98.005 13.772 103.920 1.00 56.20 ATOM 384 N VAL A 355 99.198 16.758 107.584 1.00 56.64 ATOM 385 CA VAL A 355 98.517 17.047 108.854 1.00 56.37 ATOM 386 CVAL A 355 98.478 18.566 109.086 1.00 56.20 ATOM 387 O VAL A 355 97.429 19.123 109.399 1.00 55.29 ATOM 388 CB VAL A 355 99.243 16.309 110.047 1.00 56.40 ATOM 389 CG1 VAL A 355 98.476 16.491 111.354 1.00 55.19 ATOM 390 CG2 VAL A 355 99.383 14.813 109.7191.00 55.99 ATOM 391 N HIS A 356 99.616 19.234 108.914 1.00 56.56 ATOM 392 CA HIS A 356 99.668 20.689 109.087 1.00 57.22 ATOM 393 C HIS A 356 98.862 21.449 108.039 1.00 57.46 ATOM 394 O HIS A 356 98.374 22.554 108.309 1.00 57.24 ATOM 395 CB HIS A 356101.119 21.167 109.071 1.00 57.78 ATOM 396 CG HIS A 356 101.864 20.809 110.316 1.00 58.97 ATOM 397 ND1 HIS A 356 101.689 21.487 111.507 1.00 57.69 ATOM 398 CD2 HIS A 356 102.697 19.774 110.586 1.00 59.14 ATOM 399 CE1 HIS A 356 102.381 20.882 112.454 1.0058.77 ATOM 400 NE2 HIS A 356 103.001 19.841 111.922 1.00 59.96 ATOM 401 N MET A 357 98.730 20.853 106.846 1.00 57.44 ATOM 402 CA MET A 357 97.969 21.458 105.766 1.00 56.62 ATOM 403 C MET A 357 96.513 21.540 106.169 1.00 57.20 ATOM 404 O MET A 357 95.85522.535 105.872 1.00 57.88 ATOM 405 CB MET A 357 98.074 20.644 104.497 1.00 56.36 ATOM 406 CG MET A 357 97.404 21.316 103.317 1.00 55.15 ATOM 407 SD MET A 357 97.619 20.356 101.830 1.00 54.74 ATOM 408 CE MET A 357 99.420 20.228 101.751 1.00 52.92 ATOM409 N ILE A 358 95.995 20.505 106.827 1.00 56.60 ATOM 410 CA ILE A 358 94.614 20.556 107.282 1.00 56.75 ATOM 411 C ILE A 358 94.424 21.724 108.270 1.00 57.56 ATOM 412 O ILE A 358 93.376 22.355 108.292 1.00 57.84 ATOM 413 CB ILE A 358 94.217 19.299108.025 1.00 56.52 ATOM 414 CG1 ILE A 358 94.325 18.071 107.119 1.00 56.72 ATOM 415 CG2 ILE A 358 92.819 19.475 108.563 1.00 55.68 ATOM 416 CD1 ILE A 358 93.270 17.991 106.063 1.00 57.04 ATOM 417 N ASN A 359 95.428 22.001 109.102 1.00 58.53 ATOM 418 CAASN A 359 95.328 23.101 110.087 1.00 59.39 ATOM 419 C ASN A 359 95.343 24.434 109.366 1.00 59.28 ATOM 420 O ASN A 359 94.671 25.393 109.757 1.00 59.79 ATOM 421 CB ASN A 359 96.503 23.094 111.093 1.00 59.23 ATOM 422 CG ASN A 359 96.406 21.977 112.137 1.0058.85 ATOM 423 OD1 ASN A 359 97.357 21.766 112.883 1.00 58.21 ATOM 424 ND2 ASN A 359 95.259 21.280 112.207 1.00 58.60 ATOM 425 N TRP A 360 96.143 24.485 108.316 1.00 59.09 ATOM 426 CA TRP A 360 96.273 25.691 107.511 1.00 58.86 ATOM 427 C TRP A 360 94.97925.972 106.752 1.00 59.22 ATOM 428 O TRP A 360 94.404 27.049 106.907 1.00 59.55 ATOM 429 CB TRP A 360 97.433 25.524 106.539 1.00 57.75 ATOM 430 CG TRP A 360 97.432 26.496 105.428 1.00 55.96 ATOM 431 CD1 TRP A 360 97.898 27.775 105.448 1.00 55.46 ATOM432 CD2 TRP A 360 96.932 26.269 104.117 1.00 54.62 ATOM 433 NE1 TRP A 360 97.723 28.360 104.223 1.00 53.87 ATOM 434 CE2 TRP A 360 97.128 27.456 103.387 1.00 53.93 ATOM 435 CE3 TRP A 360 96.336 25.172 103.486 1.00 54.51 ATOM 436 CZ2 TRP A 360 96.75127.583 102.062 1.00 54.47 ATOM 437 CZ3 TRP A 360 95.956 25.293 102.159 1.00 54.55 ATOM 438 CH2 TRP A 360 96.164 26.491 101.461 1.00 55.14 ATOM 606 N ALA A 382 93.720 19.091 95.631 1.00 48.18 ATOM 607 CA ALA A 382 94.850 20.021 95.659 1.00 46.44 ATOM 608C ALA A 382 96.066 19.788 96.546 1.00 45.10 ATOM 609 O ALA A 382 97.059 20.502 96.421 1.00 44.69 ATOM 610 CB ALA A 382 94.313 21.418 95.944 1.00 46.52 ATOM 611 N TRP A 383 96.023 18.796 97.417 1.00 43.80 ATOM 612 CA TRP A 383 97.132 18.602 98.333 1.0042.62 ATOM 613 C TRP A 383 98.512 18.580 97.713 1.00 42.80 ATOM 614 O TRP A 383 99.418 19.269 98.192 1.00 42.64 ATOM 615 CB TRP A 383 96.935 17.356 99.180 1.00 41.81 ATOM 616 CG TRP A 383 97.078 16.095 98.441 1.00 42.13 ATOM 617 CD1 TRP A 383 96.12115.443 97.699 1.00 41.98 ATOM 618 CD2 TRP A 383 98.280 15.329 98.310 1.00 42.10 ATOM 619 NE1 TRP A 383 96.664 14.313 97.114 1.00 41.37 ATOM 620 CE2 TRP A 383 97.984 14.219 97.472 1.00 41.64 ATOM 621 CE3 TRP A 383 99.582 15.472 98.815 1.00 41.02 ATOM 622CZ2 TRP A 383 98.942 13.264 97.132 1.00 41.39 ATOM 623 CZ3 TRP A 383 100.529 14.525 98.475 1.00 40.98 ATOM 624 CH2 TRP A 383 100.205 13.430 97.639 1.00 41.01 ATOM 625 N LEU A 384 98.700 17.823 96.644 1.00 42.54 ATOM 626 CA LEU A 384 100.031 17.787 96.0491.00 42.84 ATOM 627 C LEU A 384 100.438 19.088 95.346 1.00 43.49 ATOM 628 O LEU A 384 101.630 19.377 95.233 1.00 44.08 ATOM 629 CB LEU A 384 100.172 16.594 95.094 1.00 41.56 ATOM 630 CG LEU A 384 101.523 16.480 94.387 1.00 41.31 ATOM 631 CD1 LEU A 384102.679 16.449 95.405 1.00 41.62 ATOM 632 CD2 LEU A 384 101.520 15.229 93.530 1.00 40.95 ATOM 633 N GLU A 385 99.476 19.869 94.842 1.00 44.36 ATOM 634 CA GLU A 385 99.859 21.138 94.202 1.00 44.04 ATOM 635 C GLU A 385 100.354 21.981 95.349 1.00 43.68 ATOM636 O GLU A 385 101.436 22.569 95.280 1.00 44.08 ATOM 637 CB GLU A 385 98.682 21.871 93.532 1.00 44.27 ATOM 638 CG GLU A 385 98.129 21.194 92.295 1.00 45.37 ATOM 639 CD GLU A 385 97.018 21.989 91.622 1.00 45.49 ATOM 640 OE1 GLU A 385 97.298 23.003 90.9371.00 47.13 ATOM 641 OE2 GLU A 385 95.852 21.600 91.785 1.00 45.12 ATOM 642 N ILE A 386 99.566 22.011 96.423 1.00 42.40 ATOM 643 CA ILE A 386 99.931 22.805 97.584 1.00 41.27 ATOM 644 C ILE A 386 101.317 22.465 98.129 1.00 41.05 ATOM 645 O ILE A 386102.083 23.374 98.426 1.00 41.04 ATOM 646 CB ILE A 386 98.857 22.694 98.682 1.00 41.25 ATOM 647 CG1 ILE A 386 97.560 23.323 98.161 1.00 41.02 ATOM 648 CG2 ILE A 386 99.318 23.391 99.969 1.00 40.11 ATOM 649 CD1 ILE A 386 96.406 23.327 99.158 1.00 41.13ATOM 650 N LEU A 387 101.667 21.179 98.251 1.00 40.50 ATOM 651 CA LEU A 387 103.012 20.854 98.734 1.00 38.67 ATOM 652 C LEU A 387 104.012 21.352 97.729 1.00 37.88 ATOM 653 O LEU A 387 104.989 21.978 98.081 1.00 38.53 ATOM 654 CB LEU A 387 103.241 19.36198.888 1.00 38.37 ATOM 655 CG LEU A 387 102.483 18.607 99.963 1.00 38.32 ATOM 656 CD1 LEU A 387 102.980 17.207 99.926 1.00 38.21 ATOM 657 CD2 LEU A 387 102.688 19.217 101.331 1.00 38.68 ATOM 658 N MET A 388 103.767 21.085 96.464 1.00 36.94 ATOM 659 CAMET A 388 104.704 21.522 95.468 1.00 37.35 ATOM 660 C MET A 388 105.013 23.017 95.449 1.00 37.65 ATOM 661 O MET A 388 106.181 23.403 95.272 1.00 37.12 ATOM 662 CB MET A 388 104.247 21.039 94.100 1.00 38.12 ATOM 663 CG MET A 388 104.336 19.543 94.010 1.0039.96 ATOM 664 SD MET A 388 104.131 18.976 92.374 1.00 43.43 ATOM 665 CE MET A 388 104.602 17.301 92.499 1.00 42.19 ATOM 666 N ILE A 389 104.000 23.864 95.652 1.00 37.61 ATOM 667 CA ILE A 389 104.260 25.297 95.592 1.00 37.05 ATOM 668 C ILE A 389 105.08925.716 96.800 1.00 37.88 ATOM 669 O ILE A 389 105.971 26.595 96.702 1.00 36.98 ATOM 670 CB ILE A 389 102.953 26.125 95.495 1.00 35.49 ATOM 671 CG1 ILE A 389 103.300 27.514 94.961 1.00 34.22 ATOM 672 CG2 ILE A 389 102.285 26.217 96.822 1.00 33.85 ATOM 673CD1 ILE A 389 102.156 28.318 94.504 1.00 33.77 ATOM 674 N GLY A 390 104.823 25.059 97.933 1.00 38.26 ATOM 675 CA GLY A 390 105.579 25.348 99.144 1.00 39.15 ATOM 676 C GLY A 390 107.045 24.961 98.905 1.00 39.94 ATOM 677 O GLY A 390 107.952 25.778 99.0941.00 39.41 ATOM 693 N TRP A 393 108.644 27.458 96.768 1.00 46.72 ATOM 694 CA TRP A 393 108.925 28.703 97.470 1.00 48.60 ATOM 695 C TRP A 393 110.211 28.586 98.301 1.00 49.48 ATOM 696 O TRP A 393 111.101 29.434 98.214 1.00 49.93 ATOM 697 CB TRP A 393107.737 29.024 98.368 1.00 48.90 ATOM 698 CG TRP A 393 107.887 30.184 99.292 1.00 48.84 ATOM 699 CD1 TRP A 393 107.712 30.170 100.653 1.00 49.55

ATOM 700 CD2 TRP A 393 108.060 31.550 98.930 1.00 49.05 ATOM 701 NE1 TRP A 393 107.755 31.455 101.162 1.00 49.29 ATOM 702 CE2 TRP A 393 107.965 32.321 100.124 1.00 48.99 ATOM 703 CE3 TRP A 393 108.278 32.208 97.712 1.00 50.02 ATOM 704 CZ2 TRP A393 108.082 33.712 100.134 1.00 49.14 ATOM 705 CZ3 TRP A 393 108.393 33.614 97.718 1.00 50.46 ATOM 706 CH2 TRP A 393 108.293 34.344 98.927 1.00 49.90 ATOM 707 N ARG A 394 110.295 27.531 99.105 1.00 50.21 ATOM 708 CA ARG A 394 111.461 27.274 99.960 1.0050.94 ATOM 709 C ARG A 394 112.756 27.068 99.155 1.00 52.04 ATOM 710 O ARG A 394 113.844 27.404 99.643 1.00 52.38 ATOM 711 CB ARG A 394 111.262 26.006 100.809 1.00 50.31 ATOM 712 CG ARG A 394 110.034 25.974 101.674 1.00 50.30 ATOM 713 CD ARG A 394110.153 24.878 102.698 1.00 49.88 ATOM 714 NE ARG A 394 109.924 23.537 102.187 1.00 49.74 ATOM 715 CZ ARG A 394 108.716 23.038 101.973 1.00 50.74 ATOM 716 NH1 ARG A 394 107.641 23.780 102.224 1.00 51.52 ATOM 717 NH2 ARG A 394 108.572 21.792 101.552 1.0050.41 ATOM 732 N GLU A 397 115.749 30.358 97.413 1.00 59.67 ATOM 733 CA GLU A 397 117.049 30.786 97.986 1.00 60.86 ATOM 734 C GLU A 397 118.156 29.784 97.665 1.00 60.54 ATOM 735 O GLU A 397 119.328 30.062 97.922 1.00 61.19 ATOM 736 CB GLU A 397 116.97430.899 99.534 1.00 62.68 ATOM 737 CG GLU A 397 116.006 31.953 100.067 1.00 65.83 ATOM 738 CD GLU A 397 116.522 33.384 99.863 1.00 67.85 ATOM 739 OE1 GLU A 397 117.298 33.861 100.728 1.00 68.99 ATOM 740 OE2 GLU A 397 116.177 34.021 98.830 1.00 68.91 ATOM803 N PRO A 406 114.567 21.882 106.062 1.00 52.84 ATOM 804 CA PRO A 406 115.835 22.473 106.457 1.00 53.87 ATOM 805 C PRO A 406 116.961 21.462 106.436 1.00 55.27 ATOM 806 O PRO A 406 118.046 21.757 105.935 1.00 55.84 ATOM 807 CB PRO A 406 115.533 22.985107.848 1.00 53.50 ATOM 808 CG PRO A 406 114.115 23.420 107.694 1.00 53.44 ATOM 809 CD PRO A 406 113.558 22.158 107.092 1.00 52.74 ATOM 1112 N PHE A 445 102.932 34.883 97.394 1.00 40.62 ATOM 1113 CA PHE A 445 102.968 33.433 97.569 1.00 39.52 ATOM 1114 CPHE A 445 101.768 32.864 98.288 1.00 39.48 ATOM 1115 O PHE A 445 101.164 31.903 97.814 1.00 40.17 ATOM 1116 CB PHE A 445 104.236 33.044 98.341 1.00 38.13 ATOM 1117 CG PHE A 445 104.251 31.623 98.840 1.00 36.69 ATOM 1118 CD1 PHE A 445 104.293 30.55597.960 1.00 35.89 ATOM 1119 CD2 PHE A 445 104.261 31.360 100.212 1.00 36.19 ATOM 1120 CE1 PHE A 445 104.350 29.242 98.442 1.00 35.78 ATOM 1121 CE2 PHE A 445 104.319 30.065 100.693 1.00 35.05 ATOM 1122 CZ PHE A 445 104.364 29.003 99.808 1.00 35.27 ATOM1123 N VAL A 446 101.418 33.438 99.430 1.00 39.54 ATOM 1124 CA VAL A 446 100.298 32.912 100.190 1.00 40.25 ATOM 1125 C VAL A 446 98.963 33.084 99.460 1.00 41.56 ATOM 1126 O VAL A 446 98.039 32.272 99.652 1.00 42.13 ATOM 1127 CB VAL A 446 100.236 33.551101.578 1.00 39.66 ATOM 1128 CG1 VAL A 446 101.518 33.255 102.312 1.00 39.41 ATOM 1129 CG2 VAL A 446 100.035 35.041 101.452 1.00 39.84 ATOM 1144 N LYS A 449 98.826 30.117 97.098 1.00 40.49 ATOM 1145 CA LYS A 449 98.582 28.832 97.766 1.00 40.08 ATOM 1146C LYS A 449 97.065 28.707 98.033 1.00 39.21 ATOM 1147 O LYS A 449 96.463 27.681 97.721 1.00 38.04 ATOM 1148 CB LYS A 449 99.418 28.783 99.070 1.00 42.46 ATOM 1149 CG LYS A 449 99.578 27.462 99.940 1.00 42.75 ATOM 1150 CD LYS A 449 100.593 27.825 101.0731.00 43.32 ATOM 1151 CE LYS A 449 100.997 26.726 102.078 1.00 45.38 ATOM 1152 NZ LYS A 449 100.059 26.334 103.235 1.00 45.31 ERbeta Site II Residues (ref. 1L2J.pdb) ATOM 84 N LEU A 273 25.561 69.746 8.280 1.00 29.28 ATOM 85 CA LEU A 273 24.842 68.8167.428 1.00 30.73 ATOM 86 C LEU A 273 23.457 69.322 7.107 1.00 32.14 ATOM 87 O LEU A 273 23.002 69.256 5.967 1.00 31.30 ATOM 88 CB LEU A 273 24.733 67.449 8.102 1.00 30.00 ATOM 89 CG LEU A 273 25.927 66.508 7.951 1.00 31.09 ATOM 90 CD1 LEU A 273 25.72265.262 8.804 1.00 29.29 ATOM 91 CD2 LEU A 273 26.090 66.130 6.472 1.00 33.12 ATOM 92 N GLU A 274 22.799 69.848 8.130 1.00 34.03 ATOM 93 CA GLU A 274 21.446 70.334 7.965 1.00 37.36 ATOM 94 C GLU A 274 21.402 71.743 7.419 1.00 37.99 ATOM 95 O GLU A 27420.411 72.152 6.825 1.00 38.85 ATOM 96 CB GLU A 274 20.712 70.268 9.297 1.00 38.49 ATOM 97 N ALA A 275 22.490 72.475 7.606 1.00 38.21 ATOM 98 CA ALA A 275 22.562 73.860 7.168 1.00 37.18 ATOM 99 C ALA A 275 22.827 73.954 5.675 1.00 36.12 ATOM 100 O ALA A275 22.533 74.959 5.038 1.00 36.11 ATOM 101 CB ALA A 275 23.645 74.578 7.943 1.00 35.11 ATOM 102 N GLU A 276 23.338 72.873 5.115 1.00 37.82 ATOM 103 CA GLU A 276 23.639 72.836 3.691 1.00 40.70 ATOM 104 C GLU A 276 22.412 73.106 2.854 1.00 41.89 ATOM 105O GLU A 276 21.405 72.425 2.974 1.00 44.28 ATOM 106 CB GLU A 276 24.204 71.470 3.289 1.00 40.51 ATOM 107 CG GLU A 276 25.707 71.443 3.107 1.00 41.75 ATOM 108 CD GLU A 276 26.158 72.093 1.824 1.00 41.08 ATOM 109 OE1 GLU A 276 25.914 71.528 0.732 1.0042.10 ATOM 110 OE2 GLU A 276 26.762 73.175 1.913 1.00 41.89 ATOM 111 N PRO A 277 22.477 74.110 1.991 1.00 43.10 ATOM 112 CA PRO A 277 21.323 74.417 1.139 1.00 45.04 ATOM 113 C PRO A 277 21.232 73.506 -0.074 1.00 47.07 ATOM 114 O PRO A 277 22.234 72.937-0.494 1.00 48.36 ATOM 115 CB PRO A 277 21.573 75.861 0.745 1.00 45.33 ATOM 116 CG PRO A 277 23.045 75.885 0.600 1.00 44.31 ATOM 117 CD PRO A 277 23.528 75.128 1.822 1.00 43.44 ATOM 118 N PRO A 278 20.028 73.356 -0.657 1.00 49.65 ATOM 119 CA PRO A 27819.860 72.488 -1.833 1.00 50.10 ATOM 120 C PRO A 278 20.412 73.155 -3.085 1.00 49.50 ATOM 121 O PRO A 278 20.314 74.367 -3.246 1.00 49.29 ATOM 122 CB PRO A 278 18.346 72.282 -1.908 1.00 51.43 ATOM 123 CG PRO A 278 17.870 72.581 -0.487 1.00 51.67 ATOM 124CD PRO A 278 18.715 73.778 -0.141 1.00 50.69 ATOM 125 N HIS A 279 20.988 72.360 -3.972 1.00 49.61 ATOM 126 CA HIS A 279 21.572 72.901 -5.187 1.00 49.19 ATOM 127 C HIS A 279 20.548 73.722 -5.941 1.00 47.98 ATOM 128 O HIS A 279 19.384 73.357 -6.022 1.0046.87 ATOM 129 CB HIS A 279 22.109 71.769 -6.070 1.00 48.45 ATOM 235 N LEU A 301 23.142 82.321 -11.653 1.00 39.42 ATOM 236 CA LEU A 301 23.297 81.248 -10.678 1.00 38.51 ATOM 237 C LEU A 301 24.074 81.762 -9.477 1.00 36.22 ATOM 238 O LEU A 301 23.68081.564 -8.335 1.00 35.05 ATOM 239 CB LEU A 301 24.040 80.071 -11.309 1.00 41.75 ATOM 240 CG LEU A 301 24.287 78.874 -10.391 1.00 43.32 ATOM 241 CD1 LEU A 301 22.964 78.215 -10.003 1.00 43.90 ATOM 242 CD2 LEU A 301 25.196 77.887 -11.100 1.00 44.77 ATOM243 N ALA A 302 25.181 82.433 -9.756 1.00 35.01 ATOM 244 CA ALA A 302 26.024 82.999 -8.719 1.00 37.36 ATOM 245 C ALA A 302 25.196 83.771 -7.705 1.00 38.89 ATOM 246 O ALA A 302 25.316 83.560 -6.498 1.00 39.07 ATOM 247 CB ALA A 302 27.061 83.915 -9.3451.00 36.91 ATOM 265 N GLU A 305 23.169 81.589 -5.589 1.00 42.82 ATOM 266 CA GLU A 305 23.951 80.823 -4.627 1.00 42.67 ATOM 267 C GLU A 305 24.482 81.691 -3.495 1.00 41.23 ATOM 268 O GLU A 305 24.567 81.235 -2.351 1.00 40.16 ATOM 269 CB GLU A 305 25.10680.126 -5.330 1.00 44.09 ATOM 270 CG GLU A 305 24.645 78.970 -6.160 1.00 44.66 ATOM 271 CD GLU A 305 25.782 78.274 -6.843 1.00 45.46 ATOM 272 OE1 GLU A 305 26.524 78.938 -7.599 1.00 43.22 ATOM 273 OE2 GLU A 305 25.931 77.056 -6.623 1.00 49.46 ATOM 274 NLEU A 306 24.840 82.935 -3.816 1.00 38.20 ATOM 275 CA LEU A 306 25.341 83.853 -2.810 1.00 36.32 ATOM 276 C LEU A 306 24.295 84.071 -1.710 1.00 36.84 ATOM 277 O LEU A 306 24.637 84.147 -0.527 1.00 39.11 ATOM 278 CB LEU A 306 25.746 85.173 -3.460 1.0030.89 ATOM 279 CG LEU A 306 27.024 85.078 -4.296 1.00 29.12 ATOM 280 CD1 LEU A 306 27.244 86.344 -5.055 1.00 28.99 ATOM 281 CD2 LEU A 306 28.213 84.831 -3.411 1.00 31.75 ATOM 282 N VAL A 307 23.024 84.144 -2.093 1.00 35.35 ATOM 283 CA VAL A 307 21.94384.325 -1.121 1.00 35.56 ATOM 284 C VAL A 307 21.963 83.154 -0.143 1.00 35.53 ATOM 285 O VAL A 307 21.982 83.334 1.078 1.00 36.47 ATOM 286 CB VAL A 307 20.561 84.367 -1.821 1.00 35.38 ATOM 287 CG1 VAL A 307 19.464 84.541 -0.812 1.00 35.78 ATOM 288 CG2VAL A 307 20.516 85.504 -2.806 1.00 37.25 ATOM 289 N HIS A 308 21.954 81.949 -0.699 1.00 35.96 ATOM 290 CA HIS A 308 21.996 80.722 0.085 1.00 35.90 ATOM 291 C HIS A 308 23.221 80.708 0.983 1.00 32.55 ATOM 292 O HIS A 308 23.175 80.248 2.122 1.00 30.70ATOM 293 CB HIS A 308 22.065 79.517 -0.850 1.00 42.30 ATOM 294 CG HIS A 308 20.738 79.096 -1.395 1.00 50.05 ATOM 295 ND1 HIS A 308 19.727 78.607 -0.593 1.00 55.44 ATOM 296 CD2 HIS A 308 20.253 79.087 -2.659 1.00 52.89 ATOM 297 CE1 HIS A 308 18.678 78.315-1.340 1.00 56.67 ATOM 298 NE2 HIS A 308 18.970 78.597 -2.598 1.00 56.96 ATOM 299 N MET A 309 24.323 81.214 0.448 1.00 28.95 ATOM 300 CA MET A 309 25.571 81.247 1.178 1.00 27.16 ATOM 301 C MET A 309 25.441 82.032 2.469 1.00 24.47 ATOM 302 O MET A 30925.939 81.613 3.503 1.00 24.53 ATOM 303 CB MET A 309 26.669 81.852 0.313 1.00 25.50 ATOM 304 CG MET A 309 28.026 81.510 0.830 1.00 26.26 ATOM 305 SD MET A 309 29.265 82.251 -0.145 1.00 30.35 ATOM 306 CE MET A 309 29.366 83.764 0.675 1.00 29.47 ATOM 307N ILE A 310 24.767 83.171 2.404 1.00 19.70 ATOM 308 CA ILE A 310 24.577 83.993 3.576 1.00 19.52 ATOM 309 C ILE A 310 23.701 83.289 4.623 1.00 21.07 ATOM 310 O ILE A 310 23.959 83.390 5.818 1.00 21.03 ATOM 311 CB ILE A 310 23.972 85.345 3.169 1.00 18.29ATOM 312 CG1 ILE A 310 24.925 86.021 2.176 1.00 16.69 ATOM 313 CG2 ILE A 310 23.728 86.209 4.403 1.00 16.22 ATOM 314 CD1 ILE A 310 24.556 87.408 1.758 1.00 17.44 ATOM 315 N SER A 311 22.673 82.572 4.176 1.00 21.38 ATOM 316 CA SER A 311 21.814 81.8385.091 1.00 21.32 ATOM 317 C SER A 311 22.670 80.769 5.732 1.00 22.38 ATOM 318 O SER A 311 22.623 80.552 6.940 1.00 27.93 ATOM 319 CB SER A 311 20.668 81.173 4.344 1.00 19.97 ATOM 320 OG SER A 311 19.790 82.141 3.825 1.00 29.81 ATOM 321 N TRP A 312 23.45180.103 4.893 1.00 18.68 ATOM 322 CA TRP A 312 24.347 79.055 5.328 1.00 16.46 ATOM 323 C TRP A 312 25.280 79.582 6.420 1.00 17.03 ATOM 324 O TRP A 312 25.408 78.979 7.485 1.00 18.99 ATOM 325 CB TRP A 312 25.147 78.551 4.120 1.00 14.40 ATOM 326 CG TRP A312 26.278 77.658 4.485 1.00 12.23 ATOM 327 CD1 TRP A 312 26.195 76.379 4.934 1.00 11.53 ATOM 328 CD2 TRP A 312 27.673 77.999 4.478 1.00 12.83 ATOM 329 NE1 TRP A 312 27.456 75.894 5.222 1.00 15.57 ATOM 330 CE2 TRP A 312 28.379 76.869 4.955 1.00 13.92ATOM 331 CE3 TRP A 312 28.391 79.150 4.137 1.00 11.91 ATOM 332 CZ2 TRP A 312 29.775 76.856 5.075 1.00 13.72 ATOM 333 CZ3 TRP A 312 29.790 79.142 4.261 1.00 11.65 ATOM 334 CH2 TRP A 312 30.460 78.006 4.736 1.00 15.65 ATOM 498 N CYS A 334 35.346 85.5841.011 1.00 10.61 ATOM 499 CA CYS A 334 35.360 84.154 0.704 1.00 8.93 ATOM 500 C CYS A 334 34.348 83.651 -0.307 1.00 10.23 ATOM 501 O CYS A 334 34.330 82.462 -0.629 1.00 6.33 ATOM 502 CB CYS A 334 35.138 83.351 1.984 1.00 13.63 ATOM 503 SG CYS A 33433.388 83.352 2.564 1.00 15.47 ATOM 504 N TRP A 335 33.494 84.530 -0.802 1.00 11.06 ATOM 505 CA TRP A 335 32.467 84.074 -1.718 1.00 15.96 ATOM 506 C TRP A 335 33.009 83.334 -2.963 1.00 18.59 ATOM 507 O TRP A 335 32.468 82.297 -3.360 1.00 20.05 ATOM 508CB TRP A 335 31.554 85.252 -2.108 1.00 15.63 ATOM 509 CG TRP A 335 32.165 86.212 -3.056 1.00 13.54 ATOM 510 CD1 TRP A 335 32.908 87.306 -2.753 1.00 11.75 ATOM 511 CD2 TRP A 335 32.175 86.098 -4.486 1.00 15.51 ATOM 512 NE1 TRP A 335 33.389 87.876 -3.9001.00 13.51 ATOM 513 CE2 TRP A 335 32.953 87.147 -4.983 1.00 16.55 ATOM 514 CE3 TRP A 335 31.592 85.196 -5.395 1.00 15.54 ATOM 515 CZ2 TRP A 335 33.184 87.330 -6.357 1.00 16.36 ATOM 516 CZ3 TRP A 335 31.817 85.376 -6.758 1.00 13.43 ATOM 517 CH2 TRP A 33532.604 86.433 -7.222 1.00 15.29 ATOM 518 N MET A 336 34.084 83.850 -3.564 1.00 19.76 ATOM 519 CA MET A 336 34.680 83.226 -4.746 1.00 18.53 ATOM 520 C MET A 336 35.102 81.806 -4.427 1.00 16.57 ATOM 521 O MET A 336 34.711 80.840 -5.084 1.00 13.78 ATOM 522CB MET A 336 35.898 84.018 -5.183 1.00 25.38 ATOM 523 CG MET A 336 36.622 83.455 -6.405 1.00 32.05 ATOM 524 SD MET A 336 35.649 83.602 -7.882 1.00 40.49 ATOM 525 CE MET A 336 36.142 85.307 -8.404 1.00 37.86 ATOM 526 N GLU A 337 35.915 81.695 -3.390 1.0014.84 ATOM 527 CA GLU A 337 36.403 80.413 -2.964 1.00 12.50 ATOM 528 C GLU A 337 35.278 79.455 -2.578 1.00 12.56 ATOM 529 O GLU A 337 35.328 78.295 -2.922 1.00 13.22 ATOM 530 CB GLU A 337 37.372 80.604 -1.810 1.00 8.55 ATOM 531 CG GLU A 337 38.383 79.505-1.706 1.00 14.40 ATOM 532 CD GLU A 337 39.372 79.719 -0.553 1.00 18.30 ATOM 533 OE1 GLU A 337 39.685 80.890 -0.242 1.00 18.01 ATOM 534 OE2 GLU A 337 39.845 78.720 0.038 1.00 15.07 ATOM 535 N VAL A 338 34.256 79.935 -1.877 1.00 12.46 ATOM 536 CA VAL A338 33.161 79.069 -1.464 1.00 11.85 ATOM 537 C VAL A 338 32.382 78.626 -2.699 1.00 13.28 ATOM 538 O VAL A 338 31.961 77.470 -2.799 1.00 10.19 ATOM 539 CB VAL A 338 32.254 79.802 -0.408 1.00 15.77 ATOM 540 CG1 VAL A 338 30.938 79.099 -0.206 1.00 16.03ATOM 541 CG2 VAL A 338 32.973 79.849 0.922 1.00 15.48 ATOM 542 N LEU A 339 32.211 79.522 -3.669 1.00 15.67 ATOM 543 CA LEU A 339 31.494 79.131 -4.876 1.00 17.55 ATOM 544 C LEU A 339 32.298 78.064 -5.590 1.00 18.67 ATOM 545 O LEU A 339 31.751 77.065-6.047 1.00 18.92 ATOM 546 CB LEU A 339 31.275 80.324 -5.809 1.00 20.11 ATOM 547 CG LEU A 339 30.055 81.239 -5.647 1.00 19.03 ATOM 548 CD1 LEU A 339 30.110 82.244 -6.767 1.00 19.53 ATOM 549 CD2 LEU A 339 28.753 80.479 -5.709 1.00 17.35 ATOM 550 N MET A340 33.607 78.276 -5.679 1.00 17.94 ATOM 551 CA MET A 340 34.473 77.305 -6.328 1.00 20.80 ATOM 552 C MET A 340 34.399 75.930 -5.664 1.00 22.16 ATOM 553 O MET A 340 34.195 74.927 -6.343 1.00 25.64 ATOM 554 CB MET A 340 35.907 77.825 -6.350 1.00 21.88 ATOM555 CG MET A 340 36.054 79.100 -7.160 1.00 22.21 ATOM 556 SD MET A 340 37.744 79.436 -7.509 1.00 22.03 ATOM 557 CE MET A 340 37.603 80.420 -8.952 1.00 22.39

ATOM 558 N MET A 341 34.554 75.883 -4.345 1.00 21.23 ATOM 559 CA MET A 341 34.469 74.623 -3.609 1.00 22.72 ATOM 560 C MET A 341 33.159 73.900 -3.928 1.00 25.03 ATOM 561 O MET A 341 33.131 72.683 -4.124 1.00 26.27 ATOM 562 CB MET A 341 34.52474.870 -2.104 1.00 20.25 ATOM 563 CG MET A 341 35.901 75.000 -1.516 1.00 20.06 ATOM 564 SD MET A 341 36.855 73.482 -1.656 1.00 27.93 ATOM 565 CE MET A 341 35.893 72.410 -0.741 1.00 20.39 ATOM 566 N GLY A 342 32.069 74.655 -3.974 1.00 26.08 ATOM 567 CAGLY A 342 30.776 74.061 -4.252 1.00 25.83 ATOM 568 C GLY A 342 30.671 73.519 -5.663 1.00 25.47 ATOM 569 O GLY A 342 30.003 72.519 -5.907 1.00 24.31 ATOM 586 N TRP A 345 32.604 70.110 -5.820 1.00 31.56 ATOM 587 CA TRP A 345 31.935 68.990 -5.176 1.00 31.51ATOM 588 C TRP A 345 30.811 68.380 -6.031 1.00 34.86 ATOM 589 O TRP A 345 30.627 67.151 -6.056 1.00 34.73 ATOM 590 CB TRP A 345 31.419 69.408 -3.800 1.00 24.78 ATOM 591 CG TRP A 345 30.665 68.349 -3.123 1.00 21.06 ATOM 592 CD1 TRP A 345 29.319 68.289-2.975 1.00 21.80 ATOM 593 CD2 TRP A 345 31.191 67.164 -2.503 1.00 22.45 ATOM 594 NE1 TRP A 345 28.964 67.138 -2.297 1.00 23.41 ATOM 595 CE2 TRP A 345 30.099 66.429 -1.997 1.00 22.74 ATOM 596 CE3 TRP A 345 32.478 66.645 -2.328 1.00 23.11 ATOM 597 CZ2TRP A 345 30.254 65.205 -1.329 1.00 21.55 ATOM 598 CZ3 TRP A 345 32.629 65.422 -1.663 1.00 22.09 ATOM 599 CH2 TRP A 345 31.520 64.722 -1.175 1.00 21.02 ATOM 600 N ARG A 346 30.075 69.235 -6.741 1.00 36.80 ATOM 601 CA ARG A 346 28.987 68.780 -7.601 1.0037.33 ATOM 602 C ARG A 346 29.578 68.037 -8.797 1.00 39.47 ATOM 603 O ARG A 346 29.037 67.033 -9.270 1.00 39.87 ATOM 604 CB ARG A 346 28.168 69.979 -8.100 1.00 35.61 ATOM 605 CG ARG A 346 27.515 70.790 -6.996 1.00 35.27 ATOM 606 CD ARG A 346 26.48371.733 -7.560 1.00 32.82 ATOM 607 NE ARG A 346 27.065 72.830 -8.323 1.00 29.79 ATOM 608 CZ ARG A 346 27.472 73.975 -7.788 1.00 27.93 ATOM 609 NH1 ARG A 346 27.362 74.176 -6.487 1.00 26.25 ATOM 610 NH2 ARG A 346 27.974 74.924 -8.558 1.00 27.25 ATOM 625 NASP A 349 32.433 63.755 -9.263 1.00 48.72 ATOM 626 CA ASP A 349 32.284 62.462 -9.916 1.00 49.63 ATOM 627 C ASP A 349 32.051 62.517 -11.430 1.00 50.48 ATOM 628 O ASP A 349 31.770 61.496 -12.047 1.00 52.40 ATOM 629 CB ASP A 349 31.145 61.681 -9.247 1.0050.96 ATOM 630 CG ASP A 349 31.397 61.433 -7.762 1.00 54.14 ATOM 631 OD1 ASP A 349 32.563 61.178 -7.397 1.00 57.25 ATOM 632 OD2 ASP A 349 30.437 61.476 -6.960 1.00 54.83 ATOM 695 N PRO A 358 22.357 71.048 -12.407 1.00 51.18 ATOM 696 CA PRO A 358 21.93069.832 -13.105 1.00 52.77 ATOM 697 C PRO A 358 21.782 70.051 -14.600 1.00 54.38 ATOM 698 O PRO A 358 22.245 69.241 -15.402 1.00 56.29 ATOM 699 CB PRO A 358 20.612 69.487 -12.420 1.00 51.61 ATOM 700 CG PRO A 358 20.875 69.898 -11.008 1.00 51.81 ATOM 701CD PRO A 358 21.546 71.259 -11.195 1.00 52.76 ATOM 996 N TYR A 397 34.120 67.559 3.349 1.00 24.82 ATOM 997 CA TYR A 397 33.800 68.689 2.487 1.00 23.38 ATOM 998 C TYR A 397 33.126 69.782 3.289 1.00 22.45 ATOM 999 O TYR A 397 33.530 70.937 3.245 1.00 23.10ATOM 1000 CB TYR A 397 32.879 68.208 1.359 1.00 25.09 ATOM 1001 CG TYR A 397 32.138 69.291 0.571 1.00 25.87 ATOM 1002 CD1 TYR A 397 32.822 70.219 -0.213 1.00 24.58 ATOM 1003 CD2 TYR A 397 30.744 69.374 0.609 1.00 24.99 ATOM 1004 CE1 TYR A 397 32.13671.204 -0.939 1.00 24.05 ATOM 1005 CE2 TYR A 397 30.050 70.349 -0.109 1.00 24.00 ATOM 1006 CZ TYR A 397 30.746 71.261 -0.878 1.00 26.24 ATOM 1007 OH TYR A 397 30.034 72.230 -1.569 1.00 29.36 ATOM 1008 N LEU A 398 32.110 69.411 4.049 1.00 22.21 ATOM 1009CA LEU A 398 31.397 70.397 4.835 1.00 22.58 ATOM 1010 C LEU A 398 32.272 71.129 5.849 1.00 22.08 ATOM 1011 O LEU A 398 32.127 72.339 6.027 1.00 22.04 ATOM 1012 CB LEU A 398 30.195 69.757 5.539 1.00 23.08 ATOM 1013 CG LEU A 398 29.100 69.090 4.679 1.0024.43 ATOM 1014 CD1 LEU A 398 27.860 68.904 5.536 1.00 23.58 ATOM 1015 CD2 LEU A 398 28.740 69.931 3.465 1.00 23.50 ATOM 1029 N LYS A 401 34.605 73.520 4.066 1.00 17.69 ATOM 1030 CA LYS A 401 33.897 74.681 3.542 1.00 17.79 ATOM 1031 C LYS A 401 33.76375.765 4.575 1.00 17.99 ATOM 1032 O LYS A 401 34.004 76.930 4.301 1.00 19.98 ATOM 1033 CB LYS A 401 32.510 74.284 3.068 1.00 19.62 ATOM 1034 CG LYS A 401 31.907 75.273 2.112 1.00 22.29 ATOM 1035 CD LYS A 401 30.912 74.581 1.156 1.00 24.70 ATOM 1036 CELYS A 401 29.552 74.361 1.798 1.00 24.63 ATOM 1037 NZ LYS A 401 28.970 75.682 2.242 1.00 28.13 GR Homology Model Site II Residues (ref. GR_icm_aligned.pdb) (highlighted residues of SEQ ID NO:13) ATOM 103 N GLU A 537 -11.080 4.969 -10.004 1.00 20.00 ATOM104 CA GLU A 537 -10.913 3.599 -10.490 1.00 20.00 ATOM 105 C GLU A 537 -10.384 3.551 -11.927 1.00 20.00 ATOM 106 O GLU A 537 -9.790 2.536 -12.306 1.00 20.00 ATOM 107 CB GLU A 537 -12.267 2.897 -10.362 1.00 20.00 ATOM 108 CG GLU A 537 -12.225 1.397-10.662 1.00 20.00 ATOM 109 CD GLU A 537 -12.502 1.114 -12.138 1.00 20.00 ATOM 110 OE1 GLU A 537 -12.954 2.042 -12.797 1.00 20.00 ATOM 111 OE2 GLU A 537 -12.518 -0.057 -12.489 1.00 20.00 ATOM 112 N VAL A 538 -10.481 4.647 -12.662 1.00 20.00 ATOM 113 CA VAL A 538 -9.938 4.688 -14.022 1.00 20.00 ATOM 114 C VAL A 538 -8.508 5.243 -14.060 1.00 20.00 ATOM 115 O VAL A 538 -7.739 4.908 -14.969 1.00 20.00 ATOM 116 CB VAL A 538 -10.880 5.542 -14.872 1.00 20.00 ATOM 117 CG1 VAL A 538 -10.316 5.838 -16.259 1.0020.00 ATOM 118 CG2 VAL A 538 -12.249 4.880 -14.995 1.00 20.00 ATOM 119 N ILE A 539 -8.123 5.996 -13.041 1.00 20.00 ATOM 120 CA ILE A 539 -6.742 6.497 -12.978 1.00 20.00 ATOM 121 C ILE A 539 -5.858 5.612 -12.099 1.00 20.00 ATOM 122 O ILE A 539 -4.6475.839 -11.983 1.00 20.00 ATOM 123 CB ILE A 539 -6.734 7.967 -12.548 1.00 20.00 ATOM 124 CG1 ILE A 539 -7.332 8.228 -11.167 1.00 20.00 ATOM 125 CG2 ILE A 539 -7.441 8.818 -13.596 1.00 20.00 ATOM 126 CD1 ILE A 539 -6.287 8.243 -10.060 1.00 20.00 ATOM 127 NGLU A 540 -6.479 4.616 -11.488 1.00 20.00 ATOM 128 CA GLU A 540 -5.766 3.576 -10.744 1.00 20.00 ATOM 129 C GLU A 540 -4.822 2.810 -11.678 1.00 20.00 ATOM 130 O GLU A 540 -5.227 2.388 -12.765 1.00 20.00 ATOM 131 CB GLU A 540 -6.843 2.636 -10.200 1.0020.00 ATOM 132 CG GLU A 540 -6.313 1.647 -9.170 1.00 20.00 ATOM 133 CD GLU A 540 -5.839 2.402 -7.932 1.00 20.00 ATOM 134 OE1 GLU A 540 -6.459 3.406 -7.607 1.00 20.00 ATOM 135 OE2 GLU A 540 -4.842 1.988 -7.358 1.00 20.00 ATOM 136 N PRO A 541 -3.571 2.672-11.264 1.00 20.00 ATOM 137 CA PRO A 541 -2.549 1.983 -12.062 1.00 20.00 ATOM 138 C PRO A 541 -2.768 0.470 -12.159 1.00 20.00 ATOM 139 O PRO A 541 -3.893 -0.042 -12.120 1.00 20.00 ATOM 140 CB PRO A 541 -1.247 2.285 -11.386 1.00 20.00 ATOM 141 CG PRO A541 -1.524 3.000 -10.074 1.00 20.00 ATOM 142 CD PRO A 541 -3.028 3.202 -10.012 1.00 20.00 ATOM 143 N GLU A 542 -1.656 -0.223 -12.330 1.00 20.00 ATOM 144 CA GLU A 542 -1.675 -1.669 -12.569 1.00 20.00 ATOM 145 C GLU A 542 -1.033 -2.428 -11.404 1.00 20.00ATOM 146 O GLU A 542 -0.112 -1.909 -10.762 1.00 20.00 ATOM 147 CB GLU A 542 -0.893 -1.901 -13.868 1.00 20.00 ATOM 148 CG GLU A 542 -0.941 -3.337 -14.389 1.00 20.00 ATOM 149 CD GLU A 542 -2.382 -3.754 -14.681 1.00 20.00 ATOM 150 OE1 GLU A 542 -2.844-3.471 -15.775 1.00 20.00 ATOM 151 OE2 GLU A 542 -3.015 -4.268 -13.766 1.00 20.00 ATOM 152 N VAL A 543 -1.564 -3.605 -11.102 1.00 20.00 ATOM 153 CA VAL A 543 -0.902 -4.511 -10.154 1.00 20.00 ATOM 154 C VAL A 543 0.442 -4.922 -10.758 1.00 20.00 ATOM 155 OVAL A 543 0.543 -5.236 -11.950 1.00 20.00 ATOM 156 CB VAL A 543 -1.806 -5.720 -9.890 1.00 20.00 ATOM 157 CG1 VAL A 543 -2.193 -6.445 -11.175 1.00 20.00 ATOM 158 CG2 VAL A 543 -1.191 -6.692 -8.887 1.00 20.00 ATOM 334 N LEU A 566 10.458 -4.244 -6.551 1.0020.00 ATOM 335 CA LEU A 566 9.019 -3.973 -6.485 1.00 20.00 ATOM 336 C LEU A 566 8.726 -2.637 -5.801 1.00 20.00 ATOM 337 O LEU A 566 7.849 -1.905 -6.272 1.00 20.00 ATOM 338 CB LEU A 566 8.363 -5.104 -5.708 1.00 20.00 ATOM 339 CG LEU A 566 6.853 -4.933-5.626 1.00 20.00 ATOM 340 CD1 LEU A 566 6.214 -4.892 -7.011 1.00 20.00 ATOM 341 CD2 LEU A 566 6.244 -6.046 -4.787 1.00 20.00 ATOM 361 N GLN A 570 6.584 0.298 -7.548 1.00 20.00 ATOM 362 CA GLN A 570 5.437 0.936 -6.899 1.00 20.00 ATOM 363 C GLN A 5705.643 2.432 -6.693 1.00 20.00 ATOM 364 O GLN A 570 4.656 3.173 -6.717 1.00 20.00 ATOM 365 CB GLN A 570 5.191 0.262 -5.558 1.00 20.00 ATOM 366 CG GLN A 570 4.794 -1.197 -5.748 1.00 20.00 ATOM 367 CD GLN A 570 4.596 -1.865 -4.394 1.00 20.00 ATOM 368 OE1GLN A 570 5.477 -2.575 -3.898 1.00 20.00 ATOM 369 NE2 GLN A 570 3.451 -1.593 -3.792 1.00 20.00 ATOM 370 N VAL A 571 6.883 2.894 -6.730 1.00 20.00 ATOM 371 CA VAL A 571 7.140 4.333 -6.668 1.00 20.00 ATOM 372 C VAL A 571 6.890 4.996 -8.018 1.00 20.00 ATOM373 O VAL A 571 6.212 6.032 -8.062 1.00 20.00 ATOM 374 CB VAL A 571 8.587 4.568 -6.242 1.00 20.00 ATOM 375 CG1 VAL A 571 8.981 6.032 -6.395 1.00 20.00 ATOM 376 CG2 VAL A 571 8.828 4.097 -4.813 1.00 20.00 ATOM 377 N ILE A 572 7.169 4.290 -9.103 1.0020.00 ATOM 378 CA ILE A 572 6.914 4.887 -10.416 1.00 20.00 ATOM 379 C ILE A 572 5.436 4.736 -10.799 1.00 20.00 ATOM 380 O ILE A 572 4.871 5.667 -11.388 1.00 20.00 ATOM 381 CB ILE A 572 7.910 4.311 -11.440 1.00 20.00 ATOM 382 CG1 ILE A 572 7.921 5.073-12.768 1.00 20.00 ATOM 383 CG2 ILE A 572 7.686 2.827 -11.702 1.00 20.00 ATOM 384 CD1 ILE A 572 6.842 4.607 -13.742 1.00 20.00 ATOM 385 N ALA A 573 4.754 3.770 -10.201 1.00 20.00 ATOM 386 CA ALA A 573 3.309 3.672 -10.400 1.00 20.00 ATOM 387 C ALA A 5732.561 4.657 -9.507 1.00 20.00 ATOM 388 O ALA A 573 1.566 5.243 -9.950 1.00 20.00 ATOM 389 CB ALA A 573 2.858 2.251 -10.080 1.00 20.00 ATOM 390 N ALA A 574 3.173 5.031 -8.394 1.00 20.00 ATOM 391 CA ALA A 574 2.562 6.013 -7.500 1.00 20.00 ATOM 392 C ALA A574 2.777 7.440 -7.981 1.00 20.00 ATOM 393 O ALA A 574 1.870 8.260 -7.816 1.00 20.00 ATOM 394 CB ALA A 574 3.146 5.858 -6.101 1.00 20.00 ATOM 395 N VAL A 575 3.827 7.690 -8.749 1.00 20.00 ATOM 396 CA VAL A 575 3.972 9.034 -9.313 1.00 20.00 ATOM 397 C VALA 575 3.152 9.174 -10.597 1.00 20.00 ATOM 398 O VAL A 575 2.598 10.253 -10.841 1.00 20.00 ATOM 399 CB VAL A 575 5.448 9.381 -9.531 1.00 20.00 ATOM 400 CG1 VAL A 575 6.158 8.438 -10.494 1.00 20.00 ATOM 401 CG2 VAL A 575 5.612 10.825 -9.995 1.00 20.00ATOM 402 N LYS A 576 2.810 8.050 -11.212 1.00 20.00 ATOM 403 CA LYS A 576 1.910 8.090 -12.364 1.00 20.00 ATOM 404 C LYS A 576 0.463 8.241 -11.898 1.00 20.00 ATOM 405 O LYS A 576 -0.273 9.074 -12.440 1.00 20.00 ATOM 406 CB LYS A 576 2.074 6.795 -13.1511.00 20.00 ATOM 407 CG LYS A 576 1.273 6.824 -14.447 1.00 20.00 ATOM 408 CD LYS A 576 1.761 7.935 -15.372 1.00 20.00 ATOM 409 CE LYS A 576 3.218 7.728 -15.772 1.00 20.00 ATOM 410 NZ LYS A 576 3.687 8.826 -16.634 1.00 20.00 ATOM 411 N TRP A 577 0.1747.673 -10.739 1.00 20.00 ATOM 412 CA TRP A 577 -1.144 7.819 -10.115 1.00 20.00 ATOM 413 C TRP A 577 -1.321 9.205 -9.494 1.00 20.00 ATOM 414 O TRP A 577 -2.398 9.800 -9.622 1.00 20.00 ATOM 415 CB TRP A 577 -1.242 6.744 -9.037 1.00 20.00 ATOM 416 CG TRP A577 -2.481 6.797 -8.167 1.00 20.00 ATOM 417 CD1 TRP A 577 -3.729 6.312 -8.478 1.00 20.00 ATOM 418 CD2 TRP A 577 -2.577 7.356 -6.839 1.00 20.00 ATOM 419 NE1 TRP A 577 -4.558 6.554 -7.433 1.00 20.00 ATOM 420 CE2 TRP A 577 -3.911 7.181 -6.434 1.00 20.00ATOM 421 CE3 TRP A 577 -1.662 7.973 -5.997 1.00 20.00 ATOM 422 CZ2 TRP A 577 -4.318 7.645 -5.190 1.00 20.00 ATOM 423 CZ3 TRP A 577 -2.078 8.424 -4.751 1.00 20.00 ATOM 424 CH2 TRP A 577 -3.399 8.263 -4.350 1.00 20.00 ATOM 596 N SER A 599 4.149 9.9961.965 1.00 20.00 ATOM 597 CA SER A 599 3.110 8.965 1.912 1.00 20.00 ATOM 598 C SER A 599 3.534 7.679 1.209 1.00 20.00 ATOM 599 O SER A 599 2.773 6.704 1.271 1.00 20.00 ATOM 600 CB SER A 599 1.914 9.536 1.164 1.00 20.00 ATOM 601 OG SER A 599 2.316 9.748-0.183 1.00 20.00 ATOM 602 N TRP A 600 4.769 7.593 0.733 1.00 20.00 ATOM 603 CA TRP A 600 5.156 6.475 -0.146 1.00 20.00 ATOM 604 C TRP A 600 5.137 5.113 0.553 1.00 20.00 ATOM 605 O TRP A 600 4.590 4.167 -0.029 1.00 20.00 ATOM 606 CB TRP A 600 6.549 6.733-0.739 1.00 20.00 ATOM 607 CG TRP A 600 7.745 6.447 0.160 1.00 20.00 ATOM 608 CD1 TRP A 600 8.085 7.097 1.327 1.00 20.00 ATOM 609 CD2 TRP A 600 8.745 5.424 -0.037 1.00 20.00 ATOM 610 NE1 TRP A 600 9.207 6.530 1.830 1.00 20.00 ATOM 611 CE2 TRP A 600 9.6375.524 1.046 1.00 20.00 ATOM 612 CE3 TRP A 600 8.942 4.460 -1.016 1.00 20.00 ATOM 613 CZ2 TRP A 600 10.720 4.663 1.131 1.00 20.00 ATOM 614 CZ3 TRP A 600 10.027 3.599 -0.921 1.00 20.00 ATOM 615 CH2 TRP A 600 10.914 3.699 0.147 1.00 20.00 ATOM 616 N MET A601 5.381 5.092 1.856 1.00 20.00 ATOM 617 CA MET A 601 5.436 3.817 2.562 1.00 20.00 ATOM 618 C MET A 601 4.049 3.290 2.895 1.00 20.00 ATOM 619 O MET A 601 3.823 2.080 2.785 1.00 20.00 ATOM 620 CB MET A 601 6.242 3.989 3.842 1.00 20.00 ATOM 621 CG MET A601 7.468 3.084 3.825 1.00 20.00 ATOM 622 SD MET A 601 7.126 1.318 3.636 1.00 20.00 ATOM 623 CE MET A 601 8.822 0.695 3.653 1.00 20.00 ATOM 624 N PHE A 602 3.076 4.172 3.039 1.00 20.00 ATOM 625 CA PHE A 602 1.745 3.653 3.323 1.00 20.00 ATOM 626 C PHE A602 0.933 3.520 2.040 1.00 20.00 ATOM 627 O PHE A 602 0.010 2.702 1.997 1.00 20.00 ATOM 628 CB PHE A 602 1.018 4.502 4.354 1.00 20.00 ATOM 629 CG PHE A 602 -0.170 3.743 4.939 1.00 20.00 ATOM 630 CD1 PHE A 602 -0.131 2.353 4.994 1.00 20.00 ATOM 631 CD2PHE A 602 -1.273 4.424 5.431 1.00 20.00 ATOM 632 CE1 PHE A 602 -1.212 1.645 5.499 1.00 20.00 ATOM 633 CE2 PHE A 602 -2.354 3.714 5.938 1.00 20.00 ATOM 634 CZ PHE A 602 -2.327 2.326 5.962 1.00 20.00 ATOM 635 N LEU A 603 1.401 4.109 0.955 1.00 20.00

ATOM 636 CA LEU A 603 0.750 3.834 -0.325 1.00 20.00 ATOM 637 C LEU A 603 1.106 2.426 -0.787 1.00 20.00 ATOM 638 O LEU A 603 0.195 1.633 -1.070 1.00 20.00 ATOM 639 CB LEU A 603 1.191 4.854 -1.369 1.00 20.00 ATOM 640 CG LEU A 603 0.668 6.252 -1.0621.00 20.00 ATOM 641 CD1 LEU A 603 1.188 7.258 -2.083 1.00 20.00 ATOM 642 CD2 LEU A 603 -0.856 6.278 -1.015 1.00 20.00 ATOM 643 N MET A 604 2.348 2.028 -0.558 1.00 20.00 ATOM 644 CA MET A 604 2.746 0.674 -0.947 1.00 20.00 ATOM 645 C MET A 604 2.317 -0.3840.076 1.00 20.00 ATOM 646 O MET A 604 1.938 -1.486 -0.344 1.00 20.00 ATOM 647 CB MET A 604 4.255 0.637 -1.195 1.00 20.00 ATOM 648 CG MET A 604 5.089 1.042 0.014 1.00 20.00 ATOM 649 SD MET A 604 6.873 1.110 -0.258 1.00 20.00 ATOM 650 CE MET A 604 7.149-0.608 -0.746 1.00 20.00 ATOM 651 N ALA A 605 2.106 0.011 1.323 1.00 20.00 ATOM 652 CA ALA A 605 1.640 -0.947 2.331 1.00 20.00 ATOM 653 C ALA A 605 0.122 -1.102 2.349 1.00 20.00 ATOM 654 O ALA A 605 -0.370 -2.197 2.644 1.00 20.00 ATOM 655 CB ALA A 6052.123 -0.501 3.704 1.00 20.00 ATOM 656 N PHE A 606 -0.597 -0.112 1.845 1.00 20.00 ATOM 657 CA PHE A 606 -2.052 -0.234 1.754 1.00 20.00 ATOM 658 C PHE A 606 -2.409 -0.954 0.461 1.00 20.00 ATOM 659 O PHE A 606 -3.386 -1.715 0.419 1.00 20.00 ATOM 660 CBPHE A 606 -2.665 1.161 1.767 1.00 20.00 ATOM 661 CG PHE A 606 -4.092 1.228 2.298 1.00 20.00 ATOM 662 CD1 PHE A 606 -4.513 0.331 3.272 1.00 20.00 ATOM 663 CD2 PHE A 606 -4.968 2.195 1.821 1.00 20.00 ATOM 664 CE1 PHE A 606 -5.808 0.403 3.768 1.00 20.00ATOM 665 CE2 PHE A 606 -6.262 2.268 2.319 1.00 20.00 ATOM 666 CZ PHE A 606 -6.683 1.371 3.292 1.00 20.00 ATOM 667 N ALA A 607 -1.494 -0.893 -0.496 1.00 20.00 ATOM 668 CA ALA A 607 -1.629 -1.694 -1.711 1.00 20.00 ATOM 669 C ALA A 607 -1.379 -3.161 -1.3891.00 20.00 ATOM 670 O ALA A 607 -2.225 -3.998 -1.718 1.00 20.00 ATOM 671 CB ALA A 607 -0.616 -1.213 -2.745 1.00 20.00 ATOM 684 N TRP A 610 -4.529 -4.496 0.500 1.00 20.00 ATOM 685 CA TRP A 610 -5.667 -4.797 -0.368 1.00 20.00 ATOM 686 C TRP A 610 -5.403-5.914 -1.376 1.00 20.00 ATOM 687 O TRP A 610 -6.325 -6.688 -1.660 1.00 20.00 ATOM 688 CB TRP A 610 -5.999 -3.528 -1.132 1.00 20.00 ATOM 689 CG TRP A 610 -7.315 -3.587 -1.870 1.00 20.00 ATOM 690 CD1 TRP A 610 -7.512 -3.767 -3.222 1.00 20.00 ATOM 691 CD2TRP A 610 -8.622 -3.458 -1.278 1.00 20.00 ATOM 692 NE1 TRP A 610 -8.847 -3.743 -3.466 1.00 20.00 ATOM 693 CE2 TRP A 610 -9.547 -3.552 -2.330 1.00 20.00 ATOM 694 CE3 TRP A 610 -9.059 -3.259 0.025 1.00 20.00 ATOM 695 CZ2 TRP A 610 -10.900 -3.436 -2.0681.00 20.00 ATOM 696 CZ3 TRP A 610 -10.418 -3.148 0.279 1.00 20.00 ATOM 697 CH2 TRP A 610 -11.335 -3.235 -0.762 1.00 20.00 ATOM 698 N ARG A 611 -4.156 -6.131 -1.756 1.00 20.00 ATOM 699 CA ARG A 611 -3.861 -7.238 -2.668 1.00 20.00 ATOM 700 C ARG A 611-3.829 -8.565 -1.923 1.00 20.00 ATOM 701 O ARG A 611 -4.278 -9.580 -2.467 1.00 20.00 ATOM 702 CB ARG A 611 -2.519 -7.006 -3.348 1.00 20.00 ATOM 703 CG ARG A 611 -2.552 -5.803 -4.281 1.00 20.00 ATOM 704 CD ARG A 611 -1.201 -5.612 -4.954 1.00 20.00 ATOM705 NE ARG A 611 -0.138 -5.503 -3.943 1.00 20.00 ATOM 706 CZ ARG A 611 0.984 -4.805 -4.125 1.00 20.00 ATOM 707 NH1 ARG A 611 1.197 -4.175 -5.283 1.00 20.00 ATOM 708 NH2 ARG A 611 1.898 -4.748 -3.154 1.00 20.00 ATOM 727 N ARG A 614 -7.642 -9.259 -1.4721.00 20.00 ATOM 728 CA ARG A 614 -8.243 -9.807 -2.687 1.00 20.00 ATOM 729 C ARG A 614 -7.722 -11.191 -3.065 1.00 20.00 ATOM 730 O ARG A 614 -8.480 -12.164 -2.979 1.00 20.00 ATOM 731 CB ARG A 614 -7.982 -8.840 -3.834 1.00 20.00 ATOM 732 CG ARG A 614-8.818 -7.576 -3.688 1.00 20.00 ATOM 733 CD ARG A 614 -10.305 -7.915 -3.709 1.00 20.00 ATOM 734 NE ARG A 614 -11.140 -6.705 -3.660 1.00 20.00 ATOM 735 CZ ARG A 614 -11.850 -6.273 -4.706 1.00 20.00 ATOM 736 NH1 ARG A 614 -11.803 -6.934 -5.865 1.00 20.00ATOM 737 NH2 ARG A 614 -12.598 -5.173 -4.597 1.00 20.00 ATOM 738 N GLN A 615 -6.423 -11.316 -3.284 1.00 20.00 ATOM 739 CA GLN A 615 -5.898 -12.536 -3.912 1.00 20.00 ATOM 740 C GLN A 615 -5.649 -13.696 -2.939 1.00 20.00 ATOM 741 O GLN A 615 -5.544 -14.844-3.387 1.00 20.00 ATOM 742 CB GLN A 615 -4.608 -12.166 -4.650 1.00 20.00 ATOM 743 CG GLN A 615 -4.148 -13.276 -5.595 1.00 20.00 ATOM 744 CD GLN A 615 -2.882 -12.878 -6.352 1.00 20.00 ATOM 745 OE1 GLN A 615 -2.647 -11.698 -6.641 1.00 20.00 ATOM 746 NE2GLN A 615 -2.103 -13.886 -6.702 1.00 20.00 ATOM 810 N PRO A 625 1.353 -10.802 -8.117 1.00 20.00 ATOM 811 CA PRO A 625 0.837 -12.115 -8.533 1.00 20.00 ATOM 812 C PRO A 625 1.938 -13.187 -8.632 1.00 20.00 ATOM 813 O PRO A 625 1.677 -14.360 -8.344 1.0020.00 ATOM 814 CB PRO A 625 0.196 -11.871 -9.866 1.00 20.00 ATOM 815 CG PRO A 625 0.452 -10.433 -10.295 1.00 20.00 ATOM 816 CD PRO A 625 1.237 -9.785 -9.168 1.00 20.00 ATOM 1129 N TYR A 663 -11.805 2.057 -0.132 1.00 20.00 ATOM 1130 CA TYR A 663 -10.3531.872 -0.181 1.00 20.00 ATOM 1131 C TYR A 663 -9.660 2.895 -1.077 1.00 20.00 ATOM 1132 O TYR A 663 -8.661 3.484 -0.649 1.00 20.00 ATOM 1133 CB TYR A 663 -10.054 0.473 -0.710 1.00 20.00 ATOM 1134 CG TYR A 663 -8.576 0.255 -1.027 1.00 20.00 ATOM 1135 CD1TYR A 663 -7.664 0.076 0.005 1.00 20.00 ATOM 1136 CD2 TYR A 663 -8.143 0.241 -2.348 1.00 20.00 ATOM 1137 CE1 TYR A 663 -6.318 -0.101 -0.284 1.00 20.00 ATOM 1138 CE2 TYR A 663 -6.797 0.067 -2.638 1.00 20.00 ATOM 1139 CZ TYR A 663 -5.887 -0.099 -1.603 1.0020.00 ATOM 1140 OH TYR A 663 -4.550 -0.263 -1.885 1.00 20.00 ATOM 1141 N LEU A 664 -10.297 3.279 -2.170 1.00 20.00 ATOM 1142 CA LEU A 664 -9.673 4.228 -3.097 1.00 20.00 ATOM 1143 C LEU A 664 -9.708 5.650 -2.549 1.00 20.00 ATOM 1144 O LEU A 664 -8.6886.352 -2.613 1.00 20.00 ATOM 1145 CB LEU A 664 -10.414 4.173 -4.432 1.00 20.00 ATOM 1146 CG LEU A 664 -9.675 3.386 -5.519 1.00 20.00 ATOM 1147 CD1 LEU A 664 -9.285 1.975 -5.097 1.00 20.00 ATOM 1148 CD2 LEU A 664 -10.512 3.325 -6.788 1.00 20.00 ATOM 1163N LYS A 667 -7.067 5.761 0.246 1.00 20.00 ATOM 1164 CA LYS A 667 -5.708 5.727 -0.288 1.00 20.00 ATOM 1165 C LYS A 667 -5.292 7.076 -0.870 1.00 20.00 ATOM 1166 O LYS A 667 -4.158 7.509 -0.631 1.00 20.00 ATOM 1167 CB LYS A 667 -5.665 4.646 -1.358 1.0020.00 ATOM 1168 CG LYS A 667 -4.275 4.476 -1.961 1.00 20.00 ATOM 1169 CD LYS A 667 -4.239 3.443 -3.090 1.00 20.00 ATOM 1170 CE LYS A 667 -4.633 4.000 -4.463 1.00 20.00 ATOM 1171 NZ LYS A 667 -6.057 4.359 -4.580 1.00 20.00 MR Homology Model Site IIResidues (ref. MR_homo.pdb) (highlighted residues of SEQ ID NO:11) ATOM 88 N GLU 13 50.931 27.871 20.999 1.00 0.00 ATOM 89 CA GLU 13 50.817 29.290 20.819 1.00 0.00 ATOM 90 CB GLU 13 52.092 29.933 20.251 1.00 0.00 ATOM 91 CG GLU 13 52.003 31.458 20.1531.00 0.00 ATOM 92 CD GLU 13 53.314 31.973 19.577 1.00 0.00 ATOM 93 OE1 GLU 13 54.151 31.126 19.165 1.00 0.00 ATOM 94 OE2 GLU 13 53.496 33.219 19.541 1.00 0.00 ATOM 95 C GLU 13 49.713 29.586 19.852 1.00 0.00 ATOM 96 O GLU 13 48.968 30.550 20.026 1.00 0.00ATOM 97 N ASN 14 49.577 28.760 18.799 1.00 0.00 ATOM 98 CA ASN 14 48.615 29.036 17.770 1.00 0.00 ATOM 99 CB ASN 14 48.697 28.039 16.602 1.00 0.00 ATOM 100 CG ASN 14 47.913 28.622 15.435 1.00 0.00 ATOM 101 OD1 ASN 14 47.172 29.591 15.587 1.00 0.00 ATOM102 ND2 ASN 14 48.079 28.011 14.231 1.00 0.00 ATOM 103 C ASN 14 47.213 28.992 18.312 1.00 0.00 ATOM 104 O ASN 14 46.392 29.849 17.996 1.00 0.00 ATOM 105 N ILE 15 46.916 27.976 19.141 1.00 0.00 ATOM 106 CA ILE 15 45.633 27.682 19.725 1.00 0.00 ATOM 107 CBILE 15 45.577 26.305 20.331 1.00 0.00 ATOM 108 CG2 ILE 15 45.787 25.295 19.190 1.00 0.00 ATOM 109 CG1 ILE 15 46.580 26.147 21.485 1.00 0.00 ATOM 110 CD1 ILE 15 46.397 24.849 22.273 1.00 0.00 ATOM 111 C ILE 15 45.189 28.695 20.741 1.00 0.00 ATOM 112 OILE 15 43.985 28.817 20.968 1.00 0.00 ATOM 113 N GLU 16 46.132 29.383 21.429 1.00 0.00 ATOM 114 CA GLU 16 45.791 30.312 22.480 1.00 0.00 ATOM 115 CB GLU 16 46.950 31.203 22.966 1.00 0.00 ATOM 116 CG GLU 16 47.969 30.501 23.864 1.00 0.00 ATOM 117 CD GLU16 47.425 30.438 25.288 1.00 0.00 ATOM 118 OE1 GLU 16 47.568 31.446 26.032 1.00 0.00 ATOM 119 OE2 GLU 16 46.859 29.373 25.652 1.00 0.00 ATOM 120 C GLU 16 44.714 31.238 22.012 1.00 0.00 ATOM 121 O GLU 16 44.677 31.697 20.871 1.00 0.00 ATOM 122 N PRO 1743.806 31.494 22.913 1.00 0.00 ATOM 123 CA PRO 17 42.694 32.337 22.590 1.00 0.00 ATOM 124 CD PRO 17 43.472 30.530 23.945 1.00 0.00 ATOM 125 CB PRO 17 41.611 32.034 23.608 1.00 0.00 ATOM 126 CG PRO 17 42.309 31.194 24.693 1.00 0.00 ATOM 127 C PRO 1743.075 33.773 22.516 1.00 0.00 ATOM 128 O PRO 17 44.063 34.167 23.133 1.00 0.00 ATOM 129 N GLU 18 42.299 34.566 21.753 1.00 0.00 ATOM 130 CA GLU 18 42.588 35.960 21.624 1.00 0.00 ATOM 131 CB GLU 18 42.033 36.612 20.340 1.00 0.00 ATOM 132 CG GLU 18 40.50936.606 20.224 1.00 0.00 ATOM 133 CD GLU 18 40.113 37.261 18.904 1.00 0.00 ATOM 134 OE1 GLU 18 40.910 38.078 18.369 1.00 0.00 ATOM 135 OE2 GLU 18 38.998 36.945 18.411 1.00 0.00 ATOM 136 C GLU 18 42.029 36.646 22.830 1.00 0.00 ATOM 137 O GLU 18 41.27236.057 23.599 1.00 0.00 ATOM 138 N ILE 19 42.420 37.916 23.039 1.00 0.00 ATOM 139 CA ILE 19 41.997 38.627 24.209 1.00 0.00 ATOM 140 CB ILE 19 42.419 40.062 24.273 1.00 0.00 ATOM 141 CG2 ILE 19 41.512 40.845 23.311 1.00 0.00 ATOM 142 CG1 ILE 19 42.33140.567 25.722 1.00 0.00 ATOM 143 CD1 ILE 19 43.339 39.889 26.650 1.00 0.00 ATOM 144 C ILE 19 40.510 38.630 24.271 1.00 0.00 ATOM 145 O ILE 19 39.822 38.676 23.253 1.00 0.00 ATOM 315 N LEU 42 33.148 37.906 32.521 1.00 0.00 ATOM 316 CA LEU 42 34.407 37.68731.875 1.00 0.00 ATOM 317 CB LEU 42 35.532 38.502 32.546 1.00 0.00 ATOM 318 CG LEU 42 36.931 38.342 31.921 1.00 0.00 ATOM 319 CD2 LEU 42 38.021 38.928 32.836 1.00 0.00 ATOM 320 CD1 LEU 42 36.974 38.932 30.502 1.00 0.00 ATOM 321 C LEU 42 34.735 36.23432.024 1.00 0.00 ATOM 322 O LEU 42 35.168 35.574 31.081 1.00 0.00 ATOM 323 N ALA 43 34.488 35.691 33.229 1.00 0.00 ATOM 324 CA ALA 43 34.795 34.322 33.518 1.00 0.00 ATOM 325 CB ALA 43 34.435 33.917 34.957 1.00 0.00 ATOM 326 C ALA 43 34.012 33.442 32.5931.00 0.00 ATOM 327 O ALA 43 34.530 32.444 32.096 1.00 0.00 ATOM 341 N GLN 46 35.564 33.506 29.250 1.00 0.00 ATOM 342 CA GLN 46 36.820 32.822 29.264 1.00 0.00 ATOM 343 CB GLN 46 37.738 33.286 30.411 1.00 0.00 ATOM 344 CG GLN 46 38.134 34.757 30.230 1.000.00 ATOM 345 CD GLN 46 39.055 35.221 31.353 1.00 0.00 ATOM 346 OE1 GLN 46 38.899 34.870 32.521 1.00 0.00 ATOM 347 NE2 GLN 46 40.057 36.060 30.978 1.00 0.00 ATOM 348 C GLN 46 36.587 31.343 29.341 1.00 0.00 ATOM 349 O GLN 46 37.340 30.564 28.760 1.00 0.00ATOM 350 N MET 47 35.544 30.909 30.075 1.00 0.00 ATOM 351 CA MET 47 35.276 29.502 30.196 1.00 0.00 ATOM 352 CB MET 47 34.190 29.155 31.227 1.00 0.00 ATOM 353 CG MET 47 34.688 29.305 32.667 1.00 0.00 ATOM 354 SD MET 47 33.526 28.732 33.942 1.00 0.00 ATOM355 CE MET 47 32.462 30.200 33.859 1.00 0.00 ATOM 356 C MET 47 34.895 28.928 28.863 1.00 0.00 ATOM 357 O MET 47 35.288 27.809 28.537 1.00 0.00 ATOM 358 N ILE 48 34.124 29.669 28.045 1.00 0.00 ATOM 359 CA ILE 48 33.739 29.134 26.768 1.00 0.00 ATOM 360 CBILE 48 32.787 30.022 25.996 1.00 0.00 ATOM 361 CG2 ILE 48 33.553 31.222 25.419 1.00 0.00 ATOM 362 CG1 ILE 48 32.045 29.216 24.915 1.00 0.00 ATOM 363 CD1 ILE 48 32.950 28.621 23.839 1.00 0.00 ATOM 364 C ILE 48 35.001 28.931 25.985 1.00 0.00 ATOM 365 O ILE48 35.171 27.932 25.288 1.00 0.00 ATOM 366 N GLN 49 35.934 29.887 26.124 1.00 0.00 ATOM 367 CA GLN 49 37.205 29.941 25.465 1.00 0.00 ATOM 368 CB GLN 49 37.951 31.181 25.969 1.00 0.00 ATOM 369 CG GLN 49 39.382 31.319 25.491 1.00 0.00 ATOM 370 CD GLN 4939.948 32.566 26.158 1.00 0.00 ATOM 371 OE1 GLN 49 40.213 33.581 25.516 1.00 0.00 ATOM 372 NE2 GLN 49 40.130 32.488 27.504 1.00 0.00 ATOM 373 C GLN 49 38.023 28.742 25.840 1.00 0.00 ATOM 374 O GLN 49 38.668 28.133 24.987 1.00 0.00 ATOM 375 N VAL 5038.021 28.376 27.136 1.00 0.00 ATOM 376 CA VAL 50 38.816 27.273 27.593 1.00 0.00 ATOM 377 CB VAL 50 38.842 27.108 29.089 1.00 0.00 ATOM 378 CG1 VAL 50 37.495 26.564 29.581 1.00 0.00 ATOM 379 CG2 VAL 50 40.035 26.208 29.442 1.00 0.00 ATOM 380 C VAL 5038.308 26.008 26.980 1.00 0.00 ATOM 381 O VAL 50 39.088 25.128 26.622 1.00 0.00 ATOM 382 N VAL 51 36.976 25.875 26.849 1.00 0.00 ATOM 383 CA VAL 51 36.414 24.678 26.294 1.00 0.00 ATOM 384 CB VAL 51 34.912 24.692 26.305 1.00 0.00 ATOM 385 CG1 VAL 5134.404 23.377 25.692 1.00 0.00 ATOM 386 CG2 VAL 51 34.430 24.941 27.746 1.00 0.00 ATOM 387 C VAL 51 36.876 24.541 24.873 1.00 0.00 ATOM 388 O VAL 51 37.293 23.464 24.449 1.00 0.00 ATOM 389 N LYS 52 36.835 25.647 24.103 1.00 0.00 ATOM 390 CA LYS 52 37.21225.627 22.715 1.00 0.00 ATOM 391 CB LYS 52 37.071 27.003 22.044 1.00 0.00 ATOM 392 CG LYS 52 35.621 27.463 21.919 1.00 0.00 ATOM 393 CD LYS 52 34.766 26.499 21.096 1.00 0.00 ATOM 394 CE LYS 52 33.303 26.924 20.964 1.00 0.00 ATOM 395 NZ LYS 52 32.56625.933 20.150 1.00 0.00 ATOM 396 C LYS 52 38.653 25.243 22.614 1.00 0.00 ATOM 397 O LYS 52 39.040 24.430 21.776 1.00 0.00 ATOM 398 N TRP 53 39.475 25.822 23.501 1.00 0.00 ATOM 399 CA TRP 53 40.895 25.630 23.554 1.00 0.00 ATOM 400 CB TRP 53 41.475 26.50124.686 1.00 0.00 ATOM 401 CG TRP 53 42.945 26.376 25.000 1.00 0.00

ATOM 402 CD2 TRP 53 43.439 25.944 26.277 1.00 0.00 ATOM 403 CD1 TRP 53 44.038 26.694 24.249 1.00 0.00 ATOM 404 NE1 TRP 53 45.184 26.480 24.978 1.00 0.00 ATOM 405 CE2 TRP 53 44.830 26.022 26.229 1.00 0.00 ATOM 406 CE3 TRP 53 42.784 25.529 27.4011.00 0.00 ATOM 407 CZ2 TRP 53 45.593 25.682 27.310 1.00 0.00 ATOM 408 CZ3 TRP 53 43.556 25.176 28.485 1.00 0.00 ATOM 409 CH2 TRP 53 44.934 25.251 28.440 1.00 0.00 ATOM 410 C TRP 53 41.189 24.182 23.822 1.00 0.00 ATOM 411 O TRP 53 42.059 23.580 23.1971.00 0.00 ATOM 581 N SER 75 39.887 22.457 37.038 1.00 0.00 ATOM 582 CA SER 75 40.947 23.398 36.753 1.00 0.00 ATOM 583 CB SER 75 41.896 22.887 35.651 1.00 0.00 ATOM 584 OG SER 75 41.214 22.807 34.408 1.00 0.00 ATOM 585 C SER 75 40.579 24.808 36.360 1.000.00 ATOM 586 O SER 75 41.475 25.646 36.275 1.00 0.00 ATOM 587 N TRP 76 39.302 25.147 36.119 1.00 0.00 ATOM 588 CA TRP 76 39.003 26.424 35.509 1.00 0.00 ATOM 589 CB TRP 76 37.491 26.643 35.310 1.00 0.00 ATOM 590 CG TRP 76 36.673 26.648 36.581 1.00 0.00ATOM 591 CD2 TRP 76 36.356 27.830 37.333 1.00 0.00 ATOM 592 CD1 TRP 76 36.081 25.605 37.232 1.00 0.00 ATOM 593 NE1 TRP 76 35.419 26.063 38.347 1.00 0.00 ATOM 594 CE2 TRP 76 35.579 27.431 38.420 1.00 0.00 ATOM 595 CE3 TRP 76 36.683 29.140 37.132 1.00 0.00ATOM 596 CZ2 TRP 76 35.116 28.340 39.328 1.00 0.00 ATOM 597 CZ3 TRP 76 36.216 30.055 38.051 1.00 0.00 ATOM 598 CH2 TRP 76 35.448 29.662 39.127 1.00 0.00 ATOM 599 C TRP 76 39.550 27.596 36.285 1.00 0.00 ATOM 600 O TRP 76 40.098 28.524 35.690 1.00 0.00ATOM 601 N MET 77 39.427 27.603 37.623 1.00 0.00 ATOM 602 CA MET 77 39.884 28.723 38.406 1.00 0.00 ATOM 603 CB MET 77 39.653 28.497 39.912 1.00 0.00 ATOM 604 CG MET 77 39.840 29.734 40.795 1.00 0.00 ATOM 605 SD MET 77 38.411 30.858 40.857 1.00 0.00 ATOM606 CE MET 77 38.558 31.470 39.157 1.00 0.00 ATOM 607 C MET 77 41.366 28.887 38.235 1.00 0.00 ATOM 608 O MET 77 41.867 30.002 38.088 1.00 0.00 ATOM 609 N CYS 78 42.110 27.767 38.260 1.00 0.00 ATOM 610 CA CYS 78 43.542 27.811 38.167 1.00 0.00 ATOM 611 CBCYS 78 44.185 26.422 38.317 1.00 0.00 ATOM 612 SG CYS 78 43.910 25.711 39.967 1.00 0.00 ATOM 613 C CYS 78 43.946 28.365 36.836 1.00 0.00 ATOM 614 O CYS 78 44.834 29.211 36.751 1.00 0.00 ATOM 615 N LEU 79 43.293 27.914 35.752 1.00 0.00 ATOM 616 CA LEU 7943.663 28.371 34.443 1.00 0.00 ATOM 617 CB LEU 79 42.854 27.695 33.325 1.00 0.00 ATOM 618 CG LEU 79 43.171 26.200 33.156 1.00 0.00 ATOM 619 CD2 LEU 79 44.680 25.969 32.963 1.00 0.00 ATOM 620 CD1 LEU 79 42.332 25.587 32.025 1.00 0.00 ATOM 621 C LEU 7943.427 29.848 34.334 1.00 0.00 ATOM 622 O LEU 79 44.252 30.571 33.778 1.00 0.00 ATOM 623 N SER 80 42.289 30.340 34.856 1.00 0.00 ATOM 624 CA SER 80 41.946 31.730 34.721 1.00 0.00 ATOM 625 CB SER 80 40.522 32.041 35.214 1.00 0.00 ATOM 626 OG SER 8039.568 31.365 34.408 1.00 0.00 ATOM 627 C SER 80 42.881 32.614 35.489 1.00 0.00 ATOM 628 O SER 80 43.304 33.653 34.986 1.00 0.00 ATOM 629 N SER 81 43.217 32.241 36.737 1.00 0.00 ATOM 630 CA SER 81 44.062 33.086 37.536 1.00 0.00 ATOM 631 CB SER 81 44.19832.596 38.989 1.00 0.00 ATOM 632 OG SER 81 45.043 33.471 39.720 1.00 0.00 ATOM 633 C SER 81 45.428 33.117 36.926 1.00 0.00 ATOM 634 O SER 81 46.124 34.129 36.980 1.00 0.00 ATOM 635 N PHE 82 45.847 31.986 36.334 1.00 0.00 ATOM 636 CA PHE 82 47.141 31.86135.731 1.00 0.00 ATOM 637 CB PHE 82 47.375 30.406 35.273 1.00 0.00 ATOM 638 CG PHE 82 48.827 30.155 35.056 1.00 0.00 ATOM 639 CD1 PHE 82 49.665 29.989 36.135 1.00 0.00 ATOM 640 CD2 PHE 82 49.346 30.051 33.788 1.00 0.00 ATOM 641 CE1 PHE 82 51.006 29.74535.955 1.00 0.00 ATOM 642 CE2 PHE 82 50.686 29.807 33.601 1.00 0.00 ATOM 643 CZ PHE 82 51.518 29.656 34.684 1.00 0.00 ATOM 644 C PHE 82 47.185 32.781 34.545 1.00 0.00 ATOM 645 O PHE 82 48.177 33.473 34.316 1.00 0.00 ATOM 646 N ALA 83 46.092 32.801 33.7551.00 0.00 ATOM 647 CA ALA 83 45.988 33.623 32.580 1.00 0.00 ATOM 648 CB ALA 83 44.678 33.392 31.807 1.00 0.00 ATOM 649 C ALA 83 46.026 35.065 32.978 1.00 0.00 ATOM 650 O ALA 83 46.677 35.883 32.329 1.00 0.00 ATOM 665 N TRP 86 49.445 36.147 33.580 1.000.00 ATOM 666 CA TRP 86 50.241 36.360 32.408 1.00 0.00 ATOM 667 CB TRP 86 50.115 35.246 31.363 1.00 0.00 ATOM 668 CG TRP 86 51.048 35.483 30.206 1.00 0.00 ATOM 669 CD2 TRP 86 52.475 35.422 30.336 1.00 0.00 ATOM 670 CD1 TRP 86 50.790 35.860 28.920 1.000.00 ATOM 671 NE1 TRP 86 51.972 36.024 28.236 1.00 0.00 ATOM 672 CE2 TRP 86 53.017 35.763 29.098 1.00 0.00 ATOM 673 CE3 TRP 86 53.268 35.120 31.407 1.00 0.00 ATOM 674 CZ2 TRP 86 54.369 35.806 28.910 1.00 0.00 ATOM 675 CZ3 TRP 86 54.629 35.153 31.211 1.000.00 ATOM 676 CH2 TRP 86 55.169 35.489 29.986 1.00 0.00 ATOM 677 C TRP 86 49.916 37.667 31.747 1.00 0.00 ATOM 678 O TRP 86 50.815 38.401 31.343 1.00 0.00 ATOM 679 N ARG 87 48.619 37.999 31.615 1.00 0.00 ATOM 680 CA ARG 87 48.224 39.208 30.946 1.00 0.00ATOM 681 CB ARG 87 46.697 39.320 30.782 1.00 0.00 ATOM 682 CG ARG 87 46.177 38.518 29.583 1.00 0.00 ATOM 683 CD ARG 87 44.654 38.499 29.424 1.00 0.00 ATOM 684 NE ARG 87 44.130 37.261 30.072 1.00 0.00 ATOM 685 CZ ARG 87 43.828 37.222 31.403 1.00 0.00 ATOM686 NH1 ARG 87 44.048 38.310 32.193 1.00 0.00 ATOM 687 NH2 ARG 87 43.301 36.089 31.951 1.00 0.00 ATOM 688 C ARG 87 48.734 40.396 31.700 1.00 0.00 ATOM 689 O ARG 87 49.153 41.387 31.106 1.00 0.00 ATOM 708 N LYS 90 52.507 40.704 31.086 1.00 0.00 ATOM 709CA LYS 90 52.874 41.161 29.777 1.00 0.00 ATOM 710 CB LYS 90 52.219 40.305 28.682 1.00 0.00 ATOM 711 CG LYS 90 52.843 40.475 27.298 1.00 0.00 ATOM 712 CD LYS 90 52.458 39.344 26.345 1.00 0.00 ATOM 713 CE LYS 90 53.062 39.476 24.949 1.00 0.00 ATOM 714 NZLYS 90 52.710 38.287 24.142 1.00 0.00 ATOM 715 C LYS 90 52.528 42.598 29.508 1.00 0.00 ATOM 716 O LYS 90 53.366 43.358 29.023 1.00 0.00 ATOM 717 N HIS 91 51.258 42.989 29.744 1.00 0.00 ATOM 718 CA HIS 91 50.834 44.320 29.395 1.00 0.00 ATOM 719 ND1 HIS 9149.206 43.769 26.718 1.00 0.00 ATOM 720 CG HIS 91 48.929 43.494 28.039 1.00 0.00 ATOM 721 NE2 HIS 91 48.198 41.788 26.757 1.00 0.00 ATOM 722 CD2 HIS 91 48.311 42.282 28.045 1.00 0.00 ATOM 723 CE1 HIS 91 48.749 42.716 25.996 1.00 0.00 ATOM 724 CB HIS 9149.316 44.393 29.172 1.00 0.00 ATOM 725 C HIS 91 51.233 45.390 30.369 1.00 0.00 ATOM 726 O HIS 91 51.759 46.435 29.998 1.00 0.00 ATOM 804 N PRO 101 41.024 44.104 28.674 1.00 0.00 ATOM 805 CA PRO 101 41.382 45.430 28.240 1.00 0.00 ATOM 806 CD PRO 10140.297 43.370 27.648 1.00 0.00 ATOM 807 CB PRO 101 41.182 45.423 26.725 1.00 0.00 ATOM 808 CG PRO 101 40.064 44.385 26.520 1.00 0.00 ATOM 809 C PRO 101 40.491 46.456 28.882 1.00 0.00 ATOM 810 O PRO 101 40.960 47.552 29.183 1.00 0.00 ATOM 1122 N TYR 13955.206 29.212 29.912 1.00 0.00 ATOM 1123 CA TYR 139 53.880 29.563 30.334 1.00 0.00 ATOM 1124 CB TYR 139 53.601 31.034 29.953 1.00 0.00 ATOM 1125 CG TYR 139 52.188 31.433 30.200 1.00 0.00 ATOM 1126 CD1 TYR 139 51.726 31.666 31.474 1.00 0.00 ATOM 1127 CD2TYR 139 51.332 31.609 29.138 1.00 0.00 ATOM 1128 CE1 TYR 139 50.420 32.046 31.682 1.00 0.00 ATOM 1129 CE2 TYR 139 50.027 31.990 29.338 1.00 0.00 ATOM 1130 CZ TYR 139 49.569 32.207 30.614 1.00 0.00 ATOM 1131 OH TYR 139 48.230 32.597 30.829 1.00 0.00 ATOM1132 C TYR 139 52.877 28.666 29.665 1.00 0.00 ATOM 1133 O TYR 139 51.978 28.133 30.316 1.00 0.00 ATOM 1134 N THR 140 53.023 28.451 28.344 1.00 0.00 ATOM 1135 CA THR 140 52.065 27.679 27.603 1.00 0.00 ATOM 1136 CB THR 140 52.355 27.654 26.126 1.00 0.00ATOM 1137 OG1 THR 140 51.289 27.029 25.427 1.00 0.00 ATOM 1138 CG2 THR 140 53.675 26.906 25.874 1.00 0.00 ATOM 1139 C THR 140 52.015 26.271 28.099 1.00 0.00 ATOM 1140 O THR 140 50.942 25.684 28.227 1.00 0.00 ATOM 1157 N LYS 143 50.485 26.019 31.567 1.000.00 ATOM 1158 CA LYS 143 49.063 26.209 31.513 1.00 0.00 ATOM 1159 CB LYS 143 48.652 27.022 30.271 1.00 0.00 ATOM 1160 CG LYS 143 48.857 28.531 30.349 1.00 0.00 ATOM 1161 CD LYS 143 47.776 29.256 31.147 1.00 0.00 ATOM 1162 CE LYS 143 46.693 29.85930.247 1.00 0.00 ATOM 1163 NZ LYS 143 46.140 28.822 29.343 1.00 0.00 ATOM 1164 C LYS 143 48.410 24.876 31.309 1.00 0.00 ATOM 1165 O LYS 143 47.403 24.565 31.944 1.00 0.00 PPARgamma Site II Residues (ref. 2PRG.pdb) (highlighted residues of SEQ ID NO:10)ATOM 93 N TYR A 219 49.317 -20.485 0.542 1.00 26.16 ATOM 94 CA TYR A 219 48.188 -21.396 0.545 1.00 27.09 ATOM 95 C TYR A 219 48.474 -22.592 -0.357 1.00 28.21 ATOM 96 O TYR A 219 48.164 -23.724 0.008 1.00 27.53 ATOM 97 CB TYR A 219 46.909 -20.661 0.1131.00 31.07 ATOM 98 CG TYR A 219 45.667 -21.528 0.102 1.00 34.26 ATOM 99 CD1 TYR A 219 45.415 -22.424 1.135 1.00 30.92 ATOM 100 CD2 TYR A 219 44.724 -21.417 -0.912 1.00 37.77 ATOM 101 CE1 TYR A 219 44.256 -23.191 1.161 1.00 35.65 ATOM 102 CE2 TYR A 21943.550 -22.181 -0.898 1.00 41.57 ATOM 103 CZ TYR A 219 43.328 -23.066 0.144 1.00 38.33 ATOM 104 OH TYR A 219 42.188 -23.837 0.171 1.00 42.57 ATOM 105 N ASP A 220 49.086 -22.357 -1.519 1.00 30.62 ATOM 106 CA ASP A 220 49.409 -23.473 -2.412 1.00 32.11 ATOM107 C ASP A 220 50.414 -24.436 -1.797 1.00 28.77 ATOM 108 O ASP A 220 50.240 -25.652 -1.888 1.00 30.81 ATOM 109 CB ASP A 220 49.983 -23.010 -3.758 1.00 31.77 ATOM 110 CG ASP A 220 48.984 -22.238 -4.593 1.00 33.82 ATOM 111 OD1 ASP A 220 47.784 -22.586-4.572 1.00 33.95 ATOM 112 OD2 ASP A 220 49.409 -21.301 -5.293 1.00 39.99 ATOM 113 N SER A 221 51.466 -23.911 -1.175 1.00 29.83 ATOM 114 CA SER A 221 52.467 -24.800 -0.597 1.00 32.70 ATOM 115 C SER A 221 51.877 -25.501 0.616 1.00 28.79 ATOM 116 O SER A221 52.251 -26.623 0.938 1.00 31.65 ATOM 117 CB SER A 221 53.743 -24.033 -0.231 1.00 33.22 ATOM 118 OG SER A 221 53.502 -23.093 0.784 1.00 42.80 ATOM 119 N TYR A 222 50.936 -24.834 1.275 1.00 32.44 ATOM 120 CA TYR A 222 50.259 -25.415 2.424 1.00 29.27ATOM 121 C TYR A 222 49.438 -26.592 1.910 1.00 31.32 ATOM 122 O TYR A 222 49.440 -27.661 2.517 1.00 33.08 ATOM 123 CB TYR A 222 49.383 -24.347 3.091 1.00 29.11 ATOM 124 CG TYR A 222 48.384 -24.814 4.128 1.00 23.58 ATOM 125 CD1 TYR A 222 47.233 -25.5213.754 1.00 25.68 ATOM 126 CD2 TYR A 222 48.526 -24.449 5.471 1.00 27.50 ATOM 127 CE1 TYR A 222 46.240 -25.839 4.690 1.00 31.92 ATOM 128 CE2 TYR A 222 47.536 -24.762 6.422 1.00 24.65 ATOM 129 CZ TYR A 222 46.394 -25.452 6.022 1.00 30.90 ATOM 130 OH TYR A222 45.392 -25.716 6.937 1.00 31.36 ATOM 131 N ILE A 223 48.751 -26.409 0.781 1.00 34.58 ATOM 132 CA ILE A 223 47.963 -27.502 0.208 1.00 34.35 ATOM 133 C ILE A 223 48.866 -28.678 -0.144 1.00 35.22 ATOM 134 O ILE A 223 48.477 -29.832 0.005 1.00 36.41ATOM 135 CB ILE A 223 47.216 -27.088 -1.085 1.00 34.59 ATOM 136 CG1 ILE A 223 46.071 -26.134 -0.754 1.00 35.22 ATOM 137 CG2 ILE A 223 46.683 -28.340 -1.803 1.00 32.70 ATOM 138 CD1 ILE A 223 45.010 -26.742 0.136 1.00 39.33 ATOM 139 N LYS A 224 50.073-28.380 -0.619 1.00 36.65 ATOM 140 CA LYS A 224 51.011 -29.434 -0.989 1.00 38.16 ATOM 141 C LYS A 224 51.738 -30.133 0.144 1.00 34.79 ATOM 142 O LYS A 224 52.132 -31.284 -0.013 1.00 35.05 ATOM 143 CB LYS A 224 52.058 -28.914 -1.974 1.00 40.32 ATOM 144 CGLYS A 224 51.555 -28.828 -3.407 1.00 50.64 ATOM 145 CD LYS A 224 52.713 -28.647 -4.382 1.00 58.74 ATOM 146 CE LYS A 224 52.248 -28.792 -5.826 1.00 58.38 ATOM 147 NZ LYS A 224 53.382 -28.721 -6.790 1.00 62.48 ATOM 148 N SER A 225 51.893 -29.457 1.281 1.0032.90 ATOM 149 CA SER A 225 52.631 -30.012 2.416 1.00 32.12 ATOM 150 C SER A 225 51.796 -30.776 3.433 1.00 33.07 ATOM 151 O SER A 225 52.283 -31.713 4.066 1.00 34.52 ATOM 152 CB SER A 225 53.380 -28.888 3.153 1.00 29.50 ATOM 153 OG SER A 225 54.250-28.179 2.287 1.00 36.10 ATOM 154 N PHE A 226 50.540 -30.375 3.589 1.00 32.08 ATOM 155 CA PHE A 226 49.664 -30.994 4.565 1.00 34.40 ATOM 156 C PHE A 226 48.522 -31.784 3.935 1.00 39.63 ATOM 157 O PHE A 226 47.620 -31.215 3.326 1.00 41.93 ATOM 158 CB PHEA 226 49.106 -29.911 5.482 1.00 30.58 ATOM 159 CG PHE A 226 50.167 -29.043 6.108 1.00 30.45 ATOM 160 CD1 PHE A 226 51.124 -29.591 6.958 1.00 26.08 ATOM 161 CD2 PHE A 226 50.211 -27.674 5.844 1.00 32.25 ATOM 162 CE1 PHE A 226 52.110 -28.790 7.535 1.0026.05 ATOM 163 CE2 PHE A 226 51.190 -26.864 6.415 1.00 31.29 ATOM 164 CZ PHE A 226 52.141 -27.423 7.261 1.00 33.33 ATOM 165 N PRO A 227 48.535 -33.113 4.107 1.00 44.70 ATOM 166 CA PRO A 227 47.529 -34.040 3.578 1.00 46.95 ATOM 167 C PRO A 227 46.124-33.753 4.093 1.00 45.50 ATOM 168 O PRO A 227 45.189 -33.532 3.315 1.00 45.30 ATOM 169 CB PRO A 227 48.041 -35.398 4.062 1.00 46.06 ATOM 170 CG PRO A 227 49.531 -35.177 4.132 1.00 50.39 ATOM 171 CD PRO A 227 49.535 -33.868 4.879 1.00 47.37 ATOM 650 N ARGA 288 53.071 -39.607 15.013 1.00 47.42 ATOM 651 CA ARG A 288 52.383 -38.698 14.108 1.00 46.07 ATOM 652 C ARG A 288 53.036 -37.325 14.091 1.00 41.26 ATOM 653 O ARG A 288 52.933 -36.595 13.111 1.00 39.85 ATOM 654 CB ARG A 288 50.905 -38.573 14.496 1.0050.86 ATOM 655 CG ARG A 288 50.176 -37.445 13.773 1.00 59.11 ATOM 656 CD ARG A 288 50.362 -37.533 12.261 1.00 65.80 ATOM 657 NE ARG A 288 50.009 -36.275 11.608 1.00 71.79 ATOM 658 CZ ARG A 288 50.278 -35.987 10.339 1.00 72.53 ATOM 659 NH1 ARG A 28850.905 -36.867 9.575 1.00 72.45 ATOM 660 NH2 ARG A 288 49.931 -34.811 9.835 1.00 76.74

ATOM 661 N SER A 289 53.717 -36.986 15.180 1.00 41.14 ATOM 662 CA SER A 289 54.394 -35.702 15.296 1.00 38.47 ATOM 663 C SER A 289 55.675 -35.710 14.463 1.00 38.98 ATOM 664 O SER A 289 56.054 -34.694 13.884 1.00 38.45 ATOM 665 CB SER A 289 54.713-35.416 16.764 1.00 39.42 ATOM 666 OG SER A 289 55.352 -34.163 16.909 1.00 46.15 ATOM 683 N ALA A 292 54.638 -34.991 11.179 1.00 42.33 ATOM 684 CA ALA A 292 54.244 -33.586 11.135 1.00 37.96 ATOM 685 C ALA A 292 55.461 -32.669 10.999 1.00 36.30 ATOM 686 OALA A 292 55.425 -31.684 10.265 1.00 37.45 ATOM 687 CB ALA A 292 53.444 -33.229 12.386 1.00 31.14 ATOM 688 N VAL A 293 56.541 -32.993 11.703 1.00 37.86 ATOM 689 CA VAL A 293 57.759 -32.189 11.631 1.00 35.96 ATOM 690 C VAL A 293 58.276 -32.092 10.193 1.0037.16 ATOM 691 O VAL A 293 58.750 -31.044 9.753 1.00 39.01 ATOM 692 CB VAL A 293 58.875 -32.795 12.503 1.00 32.38 ATOM 693 CG1 VAL A 293 60.176 -32.003 12.320 1.00 30.77 ATOM 694 CG2 VAL A 293 58.447 -32.798 13.951 1.00 32.30 ATOM 695 N GLN A 294 58.180-33.198 9.467 1.00 36.25 ATOM 696 CA GLN A 294 58.649 -33.264 8.092 1.00 32.53 ATOM 697 C GLN A 294 57.780 -32.457 7.133 1.00 29.89 ATOM 698 O GLN A 294 58.289 -31.799 6.226 1.00 28.01 ATOM 699 CB GLN A 294 58.721 -34.730 7.673 1.00 36.86 ATOM 700 CGGLN A 294 59.677 -35.533 8.566 1.00 41.69 ATOM 701 CD GLN A 294 59.618 -37.028 8.318 1.00 49.48 ATOM 702 OE1 GLN A 294 59.878 -37.503 7.210 1.00 52.48 ATOM 703 NE2 GLN A 294 59.276 -37.781 9.355 1.00 51.85 ATOM 704 N GLU A 295 56.473 -32.495 7.342 1.0026.58 ATOM 705 CA GLU A 295 55.545 -31.756 6.498 1.00 29.65 ATOM 706 C GLU A 295 55.713 -30.266 6.765 1.00 27.31 ATOM 707 O GLU A 295 55.750 -29.461 5.834 1.00 28.65 ATOM 708 CB GLU A 295 54.105 -32.164 6.816 1.00 31.76 ATOM 709 CG GLU A 295 53.894-33.662 6.874 1.00 41.29 ATOM 710 CD GLU A 295 52.489 -34.037 7.311 1.00 43.08 ATOM 711 OE1 GLU A 295 51.992 -33.456 8.296 1.00 49.49 ATOM 712 OE2 GLU A 295 51.888 -34.931 6.685 1.00 52.62 ATOM 713 N ILE A 296 55.815 -29.917 8.050 1.00 28.18 ATOM 714 CAILE A 296 55.973 -28.532 8.492 1.00 29.14 ATOM 715 C ILE A 296 57.293 -27.927 8.036 1.00 30.82 ATOM 716 O ILE A 296 57.362 -26.746 7.683 1.00 30.56 ATOM 717 CB ILE A 296 55.890 -28.429 10.037 1.00 31.25 ATOM 718 CG1 ILE A 296 54.514 -28.906 10.508 1.0033.48 ATOM 719 CG2 ILE A 296 56.121 -26.985 10.493 1.00 24.18 ATOM 720 CD1 ILE A 296 54.348 -28.908 12.015 1.00 34.47 ATOM 721 N THR A 297 58.347 -28.731 8.056 1.00 32.77 ATOM 722 CA THR A 297 59.648 -28.249 7.625 1.00 29.52 ATOM 723 C THR A 297 59.612-27.944 6.136 1.00 29.40 ATOM 724 O THR A 297 60.193 -26.961 5.679 1.00 27.20 ATOM 725 CB THR A 297 60.743 -29.282 7.902 1.00 30.55 ATOM 726 OG1 THR A 297 60.900 -29.435 9.321 1.00 31.64 ATOM 727 CG2 THR A 297 62.058 -28.841 7.261 1.00 29.15 ATOM 728 NGLU A 298 58.926 -28.792 5.381 1.00 31.50 ATOM 729 CA GLU A 298 58.810 -28.571 3.950 1.00 34.95 ATOM 730 C GLU A 298 58.034 -27.268 3.735 1.00 32.29 ATOM 731 O GLU A 298 58.417 -26.426 2.927 1.00 33.09 ATOM 732 CB GLU A 298 58.079 -29.735 3.287 1.0037.99 ATOM 733 CG GLU A 298 58.301 -29.782 1.791 1.00 53.91 ATOM 734 CD GLU A 298 59.779 -29.915 1.438 1.00 58.00 ATOM 735 OE1 GLU A 298 60.409 -30.919 1.837 1.00 66.07 ATOM 736 OE2 GLU A 298 60.312 -29.006 0.766 1.00 65.07 ATOM 737 N TYR A 299 56.942-27.095 4.468 1.00 31.49 ATOM 738 CA TYR A 299 56.167 -25.872 4.346 1.00 26.31 ATOM 739 C TYR A 299 57.009 -24.654 4.704 1.00 27.39 ATOM 740 O TYR A 299 56.949 -23.632 4.029 1.00 26.41 ATOM 741 CB TYR A 299 54.961 -25.895 5.276 1.00 25.28 ATOM 742 CG TYRA 299 54.183 -24.609 5.242 1.00 23.43 ATOM 743 CD1 TYR A 299 53.431 -24.262 4.117 1.00 24.14 ATOM 744 CD2 TYR A 299 54.232 -23.716 6.311 1.00 23.27 ATOM 745 CE1 TYR A 299 52.741 -23.054 4.052 1.00 24.89 ATOM 746 CE2 TYR A 299 53.548 -22.503 6.261 1.0025.45 ATOM 747 CZ TYR A 299 52.806 -22.183 5.126 1.00 25.47 ATOM 748 OH TYR A 299 52.139 -20.991 5.058 1.00 29.93 ATOM 914 N GLY A 321 58.998 -23.431 16.750 1.00 35.39 ATOM 915 CA GLY A 321 57.701 -23.228 16.129 1.00 35.61 ATOM 916 C GLY A 321 56.938-24.471 15.728 1.00 33.20 ATOM 917 O GLY A 321 55.727 -24.409 15.520 1.00 36.84 ATOM 918 N VAL A 322 57.620 -25.604 15.623 1.00 32.05 ATOM 919 CA VAL A 322 56.942 -26.823 15.208 1.00 32.49 ATOM 920 C VAL A 322 55.750 -27.232 16.070 1.00 31.08 ATOM 921 OVAL A 322 54.695 -27.574 15.536 1.00 36.08 ATOM 922 CB VAL A 322 57.929 -28.011 15.101 1.00 37.63 ATOM 923 CG1 VAL A 322 57.163 -29.314 14.889 1.00 42.68 ATOM 924 CG2 VAL A 322 58.851 -27.796 13.912 1.00 38.13 ATOM 925 N HIS A 323 55.891 -27.207 17.3891.00 30.11 ATOM 926 CA HIS A 323 54.754 -27.604 18.207 1.00 31.92 ATOM 927 C HIS A 323 53.594 -26.624 18.194 1.00 29.54 ATOM 928 O HIS A 323 52.441 -27.041 18.240 1.00 27.50 ATOM 929 CB HIS A 323 55.172 -27.914 19.647 1.00 30.61 ATOM 930 CG HIS A 32355.918 -29.203 19.778 1.00 34.26 ATOM 931 ND1 HIS A 323 57.291 -29.267 19.870 1.00 37.08 ATOM 932 CD2 HIS A 323 55.481 -30.487 19.767 1.00 36.78 ATOM 933 CE1 HIS A 323 57.669 -30.533 19.909 1.00 37.36 ATOM 934 NE2 HIS A 323 56.590 -31.293 19.847 1.0034.75 ATOM 935 N GLU A 324 53.888 -25.329 18.119 1.00 30.21 ATOM 936 CA GLU A 324 52.819 -24.340 18.084 1.00 27.19 ATOM 937 C GLU A 324 51.993 -24.567 16.818 1.00 28.15 ATOM 938 O GLU A 324 50.788 -24.324 16.797 1.00 28.90 ATOM 939 CB GLU A 324 53.397-22.923 18.099 1.00 24.17 ATOM 940 CG GLU A 324 54.104 -22.559 19.399 1.00 26.67 ATOM 941 CD GLU A 324 54.720 -21.166 19.374 1.00 29.48 ATOM 942 OE1 GLU A 324 54.533 -20.423 18.386 1.00 32.08 ATOM 943 OE2 GLU A 324 55.401 -20.808 20.353 1.00 29.74 ATOM944 N ILE A 325 52.650 -25.040 15.764 1.00 29.34 ATOM 945 CA ILE A 325 51.969 -25.305 14.505 1.00 27.95 ATOM 946 C ILE A 325 51.235 -26.637 14.552 1.00 27.21 ATOM 947 O ILE A 325 50.156 -26.777 13.980 1.00 26.67 ATOM 948 CB ILE A 325 52.963 -25.30813.319 1.00 29.47 ATOM 949 CG1 ILE A 325 53.570 -23.910 13.169 1.00 31.96 ATOM 950 CG2 ILE A 325 52.259 -25.746 12.023 1.00 26.17 ATOM 951 CD1 ILE A 325 54.519 -23.798 12.016 1.00 36.43 ATOM 952 N ILE A 326 51.814 -27.620 15.236 1.00 26.54 ATOM 953 CAILE A 326 51.157 -28.914 15.339 1.00 28.11 ATOM 954 C ILE A 326 49.825 -28.743 16.057 1.00 29.17 ATOM 955 O ILE A 326 48.798 -29.274 15.626 1.00 29.80 ATOM 956 CB ILE A 326 52.015 -29.929 16.118 1.00 33.05 ATOM 957 CG1 ILE A 326 53.267 -30.281 15.3061.00 31.62 ATOM 958 CG2 ILE A 326 51.185 -31.184 16.445 1.00 27.50 ATOM 959 CD1 ILE A 326 54.192 -31.278 15.993 1.00 29.00 ATOM 960 N TYR A 327 49.836 -27.981 17.145 1.00 29.50 ATOM 961 CA TYR A 327 48.620 -27.779 17.918 1.00 30.34 ATOM 962 C TYR A 32747.612 -26.890 17.221 1.00 32.40 ATOM 963 O TYR A 327 46.413 -26.984 17.487 1.00 32.56 ATOM 964 CB TYR A 327 48.967 -27.246 19.310 1.00 29.71 ATOM 965 CG TYR A 327 49.845 -28.208 20.082 1.00 27.91 ATOM 966 CD1 TYR A 327 49.495 -29.554 20.202 1.00 36.87ATOM 967 CD2 TYR A 327 51.028 -27.786 20.673 1.00 34.57 ATOM 968 CE1 TYR A 327 50.312 -30.457 20.896 1.00 39.01 ATOM 969 CE2 TYR A 327 51.850 -28.677 21.369 1.00 35.00 ATOM 970 CZ TYR A 327 51.488 -30.007 21.476 1.00 37.53 ATOM 971 OH TYR A 327 52.289-30.885 22.176 1.00 43.90 ATOM 972 N THR A 328 48.097 -26.033 16.321 1.00 33.44 ATOM 973 CA THR A 328 47.217 -25.159 15.556 1.00 27.97 ATOM 974 C THR A 328 46.500 -26.030 14.526 1.00 28.13 ATOM 975 O THR A 328 45.289 -25.925 14.341 1.00 28.36 ATOM 976 CBTHR A 328 48.015 -24.062 14.803 1.00 31.65 ATOM 977 OG1 THR A 328 48.614 -23.166 15.749 1.00 34.24 ATOM 978 CG2 THR A 328 47.100 -23.279 13.857 1.00 28.42 ATOM 979 N MET A 329 47.268 -26.894 13.866 1.00 26.24 ATOM 980 CA MET A 329 46.740 -27.792 12.8411.00 28.47 ATOM 981 C MET A 329 45.831 -28.853 13.461 1.00 30.21 ATOM 982 O MET A 329 44.822 -29.251 12.867 1.00 29.30 ATOM 983 CB MET A 329 47.893 -28.484 12.097 1.00 31.16 ATOM 984 CG MET A 329 48.870 -27.530 11.390 1.00 40.71 ATOM 985 SD MET A 32948.138 -26.605 10.026 1.00 47.88 ATOM 986 CE MET A 329 47.820 -27.914 8.823 1.00 46.75 ATOM 1000 N SER A 332 42.137 -28.210 13.823 1.00 33.69 ATOM 1001 CA SER A 332 41.327 -28.455 12.634 1.00 31.46 ATOM 1002 C SER A 332 40.688 -29.850 12.678 1.00 34.05ATOM 1003 O SER A 332 39.633 -30.071 12.093 1.00 36.02 ATOM 1004 CB SER A 332 42.180 -28.342 11.355 1.00 32.80 ATOM 1005 OG SER A 332 42.678 -27.026 11.143 1.00 34.02 ATOM 1006 N LEU A 333 41.326 -30.786 13.375 1.00 31.60 ATOM 1007 CA LEU A 333 40.827-32.157 13.445 1.00 35.66 ATOM 1008 C LEU A 333 39.978 -32.399 14.688 1.00 33.42 ATOM 1009 O LEU A 333 39.483 -33.504 14.909 1.00 38.08 ATOM 1010 CB LEU A 333 42.009 -33.136 13.436 1.00 33.49 ATOM 1011 CG LEU A 333 43.111 -32.826 12.407 1.00 39.04 ATOM1012 CD1 LEU A 333 44.221 -33.875 12.471 1.00 30.81 ATOM 1013 CD2 LEU A 333 42.513 -32.777 11.024 1.00 34.79 ATOM 1022 N ASN A 335 36.759 -31.278 17.509 1.00 37.06 ATOM 1023 CA ASN A 335 35.499 -30.613 17.799 1.00 34.66 ATOM 1024 C ASN A 335 35.479-30.749 19.317 1.00 37.43 ATOM 1025 O ASN A 335 36.424 -31.309 19.896 1.00 36.55 ATOM 1026 CB ASN A 335 34.268 -31.269 17.141 1.00 36.33 ATOM 1027 CG ASN A 335 34.033 -32.694 17.578 1.00 33.81 ATOM 1028 OD1 ASN A 335 34.175 -33.041 18.750 1.00 39.06ATOM 1029 ND2 ASN A 335 33.625 -33.526 16.635 1.00 41.11 ATOM 1030 N LYS A 336 34.438 -30.251 19.973 1.00 40.23 ATOM 1031 CA LYS A 336 34.385 -30.315 21.431 1.00 43.15 ATOM 1032 C LYS A 336 34.401 -31.726 22.021 1.00 43.02 ATOM 1033 O LYS A 336 34.794-31.908 23.177 1.00 44.52 ATOM 1034 CB LYS A 336 33.144 -29.579 21.951 1.00 49.47 ATOM 1035 CG LYS A 336 31.832 -30.233 21.565 1.00 56.12 ATOM 1036 CD LYS A 336 30.654 -29.497 22.174 1.00 63.31 ATOM 1037 CE LYS A 336 29.347 -30.208 21.859 1.00 68.69 ATOM1038 NZ LYS A 336 28.183 -29.551 22.517 1.00 72.75 ATOM 1080 N GLU A 343 44.675 -40.220 9.810 1.00 50.51 ATOM 1081 CA GLU A 343 44.295 -39.491 8.604 1.00 51.89 ATOM 1082 C GLU A 343 42.791 -39.468 8.328 1.00 50.95 ATOM 1083 O GLU A 343 42.363 -39.6227.184 1.00 50.39 ATOM 1084 CB GLU A 343 45.027 -40.082 7.397 1.00 59.73 ATOM 1085 CG GLU A 343 46.541 -40.019 7.508 1.00 68.39 ATOM 1086 CD GLU A 343 47.240 -40.616 6.302 1.00 76.46 ATOM 1087 OE1 GLU A 343 47.070 -41.832 6.049 1.00 78.36 ATOM 1088 OE2GLU A 343 47.959 -39.865 5.605 1.00 79.29 ATOM 1419 N LEU A 384 44.818 -20.042 7.630 1.00 27.46 ATOM 1420 CA LEU A 384 45.776 -20.800 8.417 1.00 27.85 ATOM 1421 C LEU A 384 47.169 -20.825 7.787 1.00 28.31 ATOM 1422 O LEU A 384 48.173 -20.663 8.478 1.0027.17 ATOM 1423 CB LEU A 384 45.259 -22.228 8.617 1.00 25.10 ATOM 1424 CG LEU A 384 43.996 -22.358 9.483 1.00 28.35 ATOM 1425 CD1 LEU A 384 43.482 -23.776 9.427 1.00 25.74 ATOM 1426 CD2 LEU A 384 44.306 -21.947 10.934 1.00 24.70 ATOM 1427 N ALA A 38547.237 -21.012 6.474 1.00 28.77 ATOM 1428 CA ALA A 385 48.541 -21.054 5.815 1.00 28.21 ATOM 1429 C ALA A 385 49.392 -19.832 6.154 1.00 23.50 ATOM 1430 O ALA A 385 50.584 -19.968 6.393 1.00 28.41 ATOM 1431 CB ALA A 385 48.373 -21.184 4.316 1.00 22.62 ATOM1451 N ILE A 388 50.323 -19.739 10.091 1.00 25.45 ATOM 1452 CA ILE A 388 51.389 -20.683 10.388 1.00 25.58 ATOM 1453 C ILE A 388 52.741 -20.079 10.026 1.00 23.26 ATOM 1454 O ILE A 388 53.724 -20.295 10.720 1.00 30.01 ATOM 1455 CB ILE A 388 51.169 -22.0049.601 1.00 29.97 ATOM 1456 CG1 ILE A 388 49.853 -22.647 10.042 1.00 38.36 ATOM 1457 CG2 ILE A 388 52.316 -22.947 9.804 1.00 36.50 ATOM 1458 CD1 ILE A 388 49.736 -22.823 11.518 1.00 31.88 PR Site II Residues (ref. 1A28.pdb) (highlighted residues of SEQ IDNO:5) ATOM 76 N MET A 692 27.562 5.259 83.253 1.00 24.62 ATOM 77 CA MET A 692 26.351 4.476 83.019 1.00 27.60 ATOM 78 C MET A 692 25.156 5.337 83.440 1.00 27.94 ATOM 79 O MET A 692 24.145 5.416 82.745 1.00 25.86 ATOM 80 CB MET A 692 26.385 3.195 83.8601.00 27.45 ATOM 81 CG MET A 692 25.197 2.289 83.686 1.00 39.52 ATOM 82 SD MET A 692 25.017 1.642 82.004 1.00 51.06 ATOM 83 CE MET A 692 24.268 3.029 81.134 1.00 52.36 ATOM 84 N SER A 693 25.296 6.010 84.574 1.00 25.24 ATOM 85 CA SER A 693 24.216 6.83585.083 1.00 31.97 ATOM 86 C SER A 693 23.878 8.044 84.219 1.00 29.88 ATOM 87 O SER A 693 22.719 8.455 84.157 1.00 28.14 ATOM 88 CB SER A 693 24.531 7.313 86.508 1.00 38.05 ATOM 89 OG SER A 693 25.623 8.222 86.526 1.00 43.01 ATOM 90 N ILE A 694 24.8658.625 83.547 1.00 25.23 ATOM 91 CA ILE A 694 24.553 9.808 82.741 1.00 26.22 ATOM 92 C ILE A 694 24.257 9.520 81.279 1.00 23.06 ATOM 93 O ILE A 694 24.031 10.442 80.504 1.00 24.41 ATOM 94 CB ILE A 694 25.669 10.875 82.813 1.00 22.83 ATOM 95 CG1 ILE A 69426.984 10.307 82.265 1.00 22.20 ATOM 96 CG2 ILE A 694 25.849 11.338 84.270 1.00 28.20 ATOM 97 CD1 ILE A 694 28.060 11.373 82.014 1.00 22.62 ATOM 98 N GLU A 695 24.257 8.242 80.899 1.00 26.89 ATOM 99 CA GLU A 695 23.969 7.876 79.517 1.00 21.93 ATOM 100 CGLU A 695 22.511 8.296 79.289 1.00 28.96 ATOM 101 O GLU A 695 21.632 7.992 80.087 1.00 29.21 ATOM 102 CB GLU A 695 24.150 6.362 79.338 1.00 34.17 ATOM 103 CG GLU A 695 24.063 5.848 77.911 1.00 34.86 ATOM 104 CD GLU A 695 25.240 6.232 77.021 1.00 45.46ATOM 105 OE1 GLU A 695 26.126 7.019 77.436 1.00 31.19 ATOM 106 OE2 GLU A 695 25.275 5.730 75.873 1.00 49.30 ATOM 107 N PRO A 696 22.242 9.037 78.215 1.00 32.33 ATOM 108 CA PRO A 696 20.865 9.469 77.961 1.00 34.70 ATOM 109 C PRO A 696 19.862 8.330 77.7641.00 30.39 ATOM 110 O PRO A 696 20.232 7.235 77.371 1.00 27.63 ATOM 111 CB PRO A 696 21.020 10.333 76.710 1.00 38.27 ATOM 112 CG PRO A 696 22.198 9.652 75.997 1.00 40.07 ATOM 113 CD PRO A 696 23.141 9.561 77.173 1.00 34.72 ATOM 114 N ASP A 697 18.5888.613 78.037 1.00 38.27 ATOM 115 CA ASP A 697 17.516 7.632 77.863 1.00 35.46 ATOM 116 C ASP A 697 17.341 7.513 76.340 1.00 35.96 ATOM 117 O ASP A 697 17.600 8.468 75.620 1.00 30.43 ATOM 118 CB ASP A 697 16.238 8.147 78.523 1.00 44.25

ATOM 119 CG ASP A 697 15.176 7.069 78.683 1.00 53.62 ATOM 120 OD1 ASP A 697 15.420 5.901 78.302 1.00 57.04 ATOM 121 OD2 ASP A 697 14.085 7.398 79.203 1.00 61.97 ATOM 122 N VAL A 698 16.909 6.359 75.841 1.00 32.80 ATOM 123 CA VAL A 698 16.7666.195 74.393 1.00 34.66 ATOM 124 C VAL A 698 15.941 7.312 73.736 1.00 28.44 ATOM 125 O VAL A 698 14.937 7.775 74.266 1.00 30.11 ATOM 126 CB VAL A 698 16.153 4.813 74.026 1.00 41.68 ATOM 127 CG1 VAL A 698 14.649 4.830 74.237 1.00 38.06 ATOM 128 CG2 VAL A698 16.517 4.451 72.586 1.00 45.80 ATOM 282 N LEU A 721 16.006 12.741 63.995 1.00 19.58 ATOM 283 CA LEU A 721 16.568 11.942 65.084 1.00 17.13 ATOM 284 C LEU A 721 17.924 12.545 65.476 1.00 16.29 ATOM 285 O LEU A 721 18.228 12.690 66.662 1.00 19.55 ATOM286 CB LEU A 721 16.742 10.479 64.638 1.00 17.00 ATOM 287 CG LEU A 721 17.378 9.549 65.673 1.00 19.10 ATOM 288 CD1 LEU A 721 16.508 9.497 66.942 1.00 18.65 ATOM 289 CD2 LEU A 721 17.536 8.145 65.037 1.00 17.08 ATOM 290 N GLY A 722 18.724 12.896 64.4761.00 16.83 ATOM 291 CA GLY A 722 20.036 13.486 64.710 1.00 17.42 ATOM 292 C GLY A 722 19.929 14.774 65.516 1.00 24.76 ATOM 293 O GLY A 722 20.749 15.038 66.402 1.00 19.56 ATOM 314 N GLN A 725 19.296 13.770 69.009 1.00 19.77 ATOM 315 CA GLN A 725 20.47413.188 69.634 1.00 19.30 ATOM 316 C GLN A 725 21.545 14.239 69.906 1.00 21.49 ATOM 317 O GLN A 725 22.309 14.113 70.855 1.00 21.43 ATOM 318 CB GLN A 725 21.055 12.063 68.771 1.00 19.47 ATOM 319 CG GLN A 725 20.135 10.843 68.774 1.00 22.41 ATOM 320 CD GLNA 725 20.746 9.633 68.092 1.00 30.53 ATOM 321 OE1 GLN A 725 20.104 8.578 67.970 1.00 32.93 ATOM 322 NE2 GLN A 725 21.987 9.770 67.647 1.00 27.09 ATOM 323 N LEU A 726 21.592 15.284 69.085 1.00 21.82 ATOM 324 CA LEU A 726 22.573 16.347 69.288 1.00 22.79ATOM 325 C LEU A 726 22.284 17.027 70.624 1.00 21.40 ATOM 326 O LEU A 726 23.207 17.293 71.406 1.00 23.41 ATOM 327 CB LEU A 726 22.526 17.367 68.135 1.00 19.53 ATOM 328 CG LEU A 726 23.533 18.531 68.138 1.00 24.90 ATOM 329 CD1 LEU A 726 24.948 18.00568.300 1.00 22.88 ATOM 330 CD2 LEU A 726 23.421 19.325 66.812 1.00 20.28 ATOM 331 N LEU A 727 21.007 17.301 70.890 1.00 18.00 ATOM 332 CA LEU A 727 20.623 17.906 72.156 1.00 19.91 ATOM 333 C LEU A 727 21.078 16.978 73.281 1.00 24.23 ATOM 334 O LEU A 72721.678 17.402 74.274 1.00 19.07 ATOM 335 CB LEU A 727 19.105 18.065 72.247 1.00 21.64 ATOM 336 CG LEU A 727 18.591 18.563 73.594 1.00 21.40 ATOM 337 CD1 LEU A 727 19.256 19.906 73.912 1.00 26.36 ATOM 338 CD2 LEU A 727 17.082 18.699 73.546 1.00 28.00ATOM 339 N SER A 728 20.783 15.695 73.106 1.00 21.94 ATOM 340 CA SER A 728 21.131 14.690 74.097 1.00 21.38 ATOM 341 C SER A 728 22.637 14.682 74.355 1.00 20.10 ATOM 342 O SER A 728 23.066 14.611 75.512 1.00 22.32 ATOM 343 CB SER A 728 20.645 13.31073.630 1.00 24.08 ATOM 344 OG SER A 728 20.719 12.380 74.689 1.00 30.43 ATOM 345 N VAL A 729 23.433 14.741 73.297 1.00 18.72 ATOM 346 CA VAL A 729 24.891 14.781 73.415 1.00 20.27 ATOM 347 C VAL A 729 25.388 15.988 74.203 1.00 18.31 ATOM 348 O VAL A 72926.274 15.860 75.049 1.00 19.16 ATOM 349 CB VAL A 729 25.574 14.796 72.034 1.00 17.15 ATOM 350 CG1 VAL A 729 27.060 15.147 72.164 1.00 20.31 ATOM 351 CG2 VAL A 729 25.453 13.395 71.407 1.00 21.83 ATOM 352 N VAL A 730 24.830 17.159 73.937 1.00 17.43 ATOM353 CA VAL A 730 25.282 18.333 74.660 1.00 21.44 ATOM 354 C VAL A 730 24.888 18.225 76.132 1.00 19.86 ATOM 355 O VAL A 730 25.678 18.584 76.993 1.00 21.47 ATOM 356 CB VAL A 730 24.725 19.630 74.038 1.00 20.22 ATOM 357 CG1 VAL A 730 25.210 20.849 74.8341.00 21.24 ATOM 358 CG2 VAL A 730 25.178 19.734 72.596 1.00 19.32 ATOM 359 N LYS A 731 23.686 17.727 76.427 1.00 17.73 ATOM 360 CA LYS A 731 23.275 17.552 77.817 1.00 22.58 ATOM 361 C LYS A 731 24.186 16.546 78.517 1.00 23.23 ATOM 362 O LYS A 731 24.61316.757 79.659 1.00 20.64 ATOM 363 CB LYS A 731 21.808 17.121 77.911 1.00 23.07 ATOM 364 CG LYS A 731 20.850 18.296 77.646 1.00 25.92 ATOM 365 CD LYS A 731 19.388 18.009 78.016 1.00 37.08 ATOM 366 CE LYS A 731 18.717 17.034 77.063 1.00 48.50 ATOM 367 NZLYS A 731 17.247 16.901 77.346 1.00 49.18 ATOM 368 N TRP A 732 24.486 15.452 77.828 1.00 18.73 ATOM 369 CA TRP A 732 25.383 14.437 78.364 1.00 21.37 ATOM 370 C TRP A 732 26.743 15.038 78.703 1.00 22.20 ATOM 371 O TRP A 732 27.293 14.772 79.770 1.00 23.93ATOM 372 CB TRP A 732 25.552 13.321 77.334 1.00 21.47 ATOM 373 CG TRP A 732 26.674 12.347 77.582 1.00 17.78 ATOM 374 CD1 TRP A 732 26.728 11.348 78.528 1.00 20.71 ATOM 375 CD2 TRP A 732 27.861 12.225 76.806 1.00 17.23 ATOM 376 NE1 TRP A 732 27.879 10.61378.370 1.00 19.88 ATOM 377 CE2 TRP A 732 28.593 11.130 77.318 1.00 19.41 ATOM 378 CE3 TRP A 732 28.383 12.938 75.713 1.00 19.83 ATOM 379 CZ2 TRP A 732 29.824 10.726 76.771 1.00 18.15 ATOM 380 CZ3 TRP A 732 29.612 12.533 75.165 1.00 20.23 ATOM 381 CH2 TRPA 732 30.314 11.435 75.701 1.00 22.27 ATOM 382 N SER A 733 27.274 15.872 77.811 1.00 20.68 ATOM 555 N SER A 754 33.038 15.988 66.904 1.00 19.69 ATOM 556 CA SER A 754 32.699 14.594 67.147 1.00 21.05 ATOM 557 C SER A 754 31.265 14.109 67.119 1.00 20.67ATOM 558 O SER A 754 31.042 12.893 67.259 1.00 17.40 ATOM 559 CB SER A 754 33.288 14.196 68.498 1.00 24.21 ATOM 560 OG SER A 754 32.556 14.827 69.535 1.00 27.35 ATOM 561 N TRP A 755 30.300 14.998 66.911 1.00 17.55 ATOM 562 CA TRP A 755 28.912 14.54766.960 1.00 21.93 ATOM 563 C TRP A 755 28.620 13.345 66.055 1.00 18.91 ATOM 564 O TRP A 755 27.956 12.409 66.486 1.00 20.07 ATOM 565 CB TRP A 755 27.925 15.684 66.647 1.00 22.52 ATOM 566 CG TRP A 755 28.003 16.222 65.257 1.00 23.08 ATOM 567 CD1 TRP A 75528.859 17.175 64.791 1.00 28.21 ATOM 568 CD2 TRP A 755 27.217 15.803 64.141 1.00 24.51 ATOM 569 NE1 TRP A 755 28.655 17.379 63.445 1.00 25.19 ATOM 570 CE2 TRP A 755 27.651 16.548 63.022 1.00 26.64 ATOM 571 CE3 TRP A 755 26.189 14.869 63.979 1.00 25.75ATOM 572 CZ2 TRP A 755 27.089 16.388 61.743 1.00 29.86 ATOM 573 CZ3 TRP A 755 25.630 14.707 62.707 1.00 32.59 ATOM 574 CH2 TRP A 755 26.083 15.465 61.608 1.00 30.85 ATOM 575 N MET A 756 29.114 13.357 64.820 1.00 21.38 ATOM 576 CA MET A 756 28.848 12.24363.896 1.00 18.69 ATOM 577 C MET A 756 29.439 10.939 64.415 1.00 23.20 ATOM 578 O MET A 756 28.794 9.878 64.350 1.00 21.19 ATOM 579 CB MET A 756 29.432 12.529 62.511 1.00 21.49 ATOM 580 CG MET A 756 29.112 11.430 61.496 1.00 22.22 ATOM 581 SD MET A 75627.367 11.449 60.920 1.00 27.03 ATOM 582 CE MET A 756 27.451 12.902 59.772 1.00 26.64 ATOM 583 N SER A 757 30.675 11.013 64.899 1.00 19.23 ATOM 584 CA SER A 757 31.344 9.845 65.451 1.00 22.32 ATOM 585 C SER A 757 30.575 9.283 66.631 1.00 20.68 ATOM 586 OSER A 757 30.376 8.078 66.718 1.00 21.09 ATOM 587 CB SER A 757 32.759 10.190 65.911 1.00 23.54 ATOM 588 OG SER A 757 33.562 10.611 64.826 1.00 31.88 ATOM 589 N LEU A 758 30.150 10.149 67.548 1.00 20.06 ATOM 590 CA LEU A 758 29.430 9.698 68.735 1.00 16.39ATOM 591 C LEU A 758 28.105 9.061 68.355 1.00 18.68 ATOM 592 O LEU A 758 27.709 8.038 68.918 1.00 18.94 ATOM 593 CB LEU A 758 29.147 10.880 69.675 1.00 14.15 ATOM 594 CG LEU A 758 30.373 11.599 70.232 1.00 20.53 ATOM 595 CD1 LEU A 758 29.919 12.85570.981 1.00 20.07 ATOM 596 CD2 LEU A 758 31.121 10.656 71.186 1.00 24.11 ATOM 597 N MET A 759 27.410 9.674 67.404 1.00 18.42 ATOM 598 CA MET A 759 26.125 9.149 67.001 1.00 19.21 ATOM 599 C MET A 759 26.209 7.828 66.242 1.00 19.93 ATOM 600 O MET A 75925.363 6.949 66.456 1.00 23.09 ATOM 601 CB MET A 759 25.364 10.197 66.193 1.00 21.20 ATOM 602 CG MET A 759 24.937 11.397 67.065 1.00 21.45 ATOM 603 SD MET A 759 23.950 12.587 66.168 1.00 25.97 ATOM 604 CE MET A 759 23.941 13.961 67.348 1.00 26.52 ATOM605 N VAL A 760 27.193 7.673 65.365 1.00 18.66 ATOM 606 CA VAL A 760 27.300 6.397 64.638 1.00 19.71 ATOM 607 C VAL A 760 27.779 5.292 65.596 1.00 22.38 ATOM 608 O VAL A 760 27.409 4.127 65.448 1.00 18.63 ATOM 609 CB VAL A 760 28.262 6.492 63.417 1.0020.60 ATOM 610 CG1 VAL A 760 29.708 6.659 63.860 1.00 22.90 ATOM 611 CG2 VAL A 760 28.129 5.226 62.559 1.00 22.05 ATOM 612 N PHE A 761 28.597 5.672 66.572 1.00 18.16 ATOM 613 CA PHE A 761 29.107 4.729 67.579 1.00 20.65 ATOM 614 C PHE A 761 27.907 4.25668.419 1.00 21.25 ATOM 615 O PHE A 761 27.773 3.058 68.717 1.00 23.39 ATOM 616 CB PHE A 761 30.166 5.441 68.447 1.00 19.84 ATOM 617 CG PHE A 761 31.100 4.502 69.206 1.00 22.22 ATOM 618 CD1 PHE A 761 31.944 3.631 68.520 1.00 22.72 ATOM 619 CD2 PHE A 76131.158 4.529 70.597 1.00 23.08 ATOM 620 CE1 PHE A 761 32.834 2.802 69.200 1.00 23.74 ATOM 621 CE2 PHE A 761 32.044 3.706 71.297 1.00 24.95 ATOM 622 CZ PHE A 761 32.880 2.842 70.602 1.00 22.67 ATOM 623 N GLY A 762 27.041 5.196 68.803 1.00 18.00 ATOM 624CA GLY A 762 25.851 4.861 69.564 1.00 19.15 ATOM 625 C GLY A 762 24.928 3.957 68.761 1.00 19.60 ATOM 626 O GLY A 762 24.304 3.038 69.306 1.00 17.94 ATOM 639 N TRP A 765 26.279 0.520 68.998 1.00 18.65 ATOM 640 CA TRP A 765 25.954 -0.118 70.265 1.00 21.70ATOM 641 C TRP A 765 24.485 -0.582 70.330 1.00 20.69 ATOM 642 O TRP A 765 24.202 -1.710 70.730 1.00 20.73 ATOM 643 CB TRP A 765 26.275 0.832 71.426 1.00 19.80 ATOM 644 CG TRP A 765 25.985 0.232 72.766 1.00 20.60 ATOM 645 CD1 TRP A 765 24.895 0.450 73.5431.00 26.35 ATOM 646 CD2 TRP A 765 26.765 -0.770 73.435 1.00 22.75 ATOM 647 NE1 TRP A 765 24.936 -0.354 74.660 1.00 25.80 ATOM 648 CE2 TRP A 765 26.076 -1.114 74.618 1.00 27.72 ATOM 649 CE3 TRP A 765 27.974 -1.408 73.145 1.00 24.76 ATOM 650 CZ2 TRP A 76526.558 -2.080 75.522 1.00 28.33 ATOM 651 CZ3 TRP A 765 28.461 -2.372 74.045 1.00 25.79 ATOM 652 CH2 TRP A 765 27.747 -2.692 75.217 1.00 23.99 ATOM 653 N ARG A 766 23.544 0.273 69.936 1.00 20.81 ATOM 654 CA ARG A 766 22.136 -0.116 69.987 1.00 18.86 ATOM655 C ARG A 766 21.844 -1.288 69.048 1.00 18.44 ATOM 656 O ARG A 766 21.066 -2.185 69.381 1.00 20.30 ATOM 657 CB ARG A 766 21.223 1.061 69.624 1.00 18.28 ATOM 658 CG ARG A 766 21.246 2.229 70.632 1.00 20.05 ATOM 659 CD ARG A 766 20.179 3.260 70.256 1.0025.08 ATOM 660 NE ARG A 766 20.413 3.889 68.956 1.00 20.13 ATOM 661 CZ ARG A 766 21.239 4.908 68.742 1.00 22.33 ATOM 662 NH1 ARG A 766 21.909 5.442 69.754 1.00 22.73 ATOM 663 NH2 ARG A 766 21.380 5.412 67.519 1.00 19.31 ATOM 682 N LYS A 769 23.313-4.427 70.751 1.00 19.61 ATOM 683 CA LYS A 769 22.500 -4.833 71.899 1.00 20.88 ATOM 684 C LYS A 769 21.090 -5.323 71.636 1.00 25.83 ATOM 685 O LYS A 769 20.661 -6.320 72.222 1.00 23.20 ATOM 686 CB LYS A 769 22.402 -3.682 72.904 1.00 26.26 ATOM 687 CG LYSA 769 23.682 -3.356 73.623 1.00 29.74 ATOM 688 CD LYS A 769 23.998 -4.345 74.756 1.00 34.33 ATOM 689 CE LYS A 769 23.010 -4.251 75.914 1.00 31.35 ATOM 690 NZ LYS A 769 23.424 -5.118 77.078 1.00 27.64 ATOM 691 N HIS A 770 20.372 -4.627 70.762 1.00 20.34ATOM 692 CA HIS A 770 18.968 -4.935 70.496 1.00 25.32 ATOM 693 C HIS A 770 18.652 -5.887 69.353 1.00 24.30 ATOM 694 O HIS A 770 17.631 -6.572 69.382 1.00 23.64 ATOM 695 CB HIS A 770 18.204 -3.622 70.246 1.00 25.43 ATOM 696 CG HIS A 770 18.239 -2.67271.397 1.00 32.32 ATOM 697 ND1 HIS A 770 17.517 -2.879 72.554 1.00 34.84 ATOM 698 CD2 HIS A 770 18.920 -1.516 71.581 1.00 28.95 ATOM 699 CE1 HIS A 770 17.751 -1.889 73.398 1.00 36.65 ATOM 700 NE2 HIS A 770 18.598 -1.049 72.833 1.00 35.04 ATOM 771 N PRO A780 14.074 3.224 68.501 1.00 24.08 ATOM 772 CA PRO A 780 13.061 2.176 68.645 1.00 22.75 ATOM 773 C PRO A 780 11.985 2.260 67.551 1.00 31.17 ATOM 774 O PRO A 780 11.405 1.242 67.163 1.00 27.19 ATOM 775 CB PRO A 780 12.506 2.451 70.039 1.00 23.42 ATOM 776CG PRO A 780 13.723 3.011 70.760 1.00 29.68 ATOM 777 CD PRO A 780 14.122 4.036 69.731 1.00 19.66 ATOM 1091 N PHE A 818 32.469 0.119 76.224 1.00 21.31 ATOM 1092 CA PHE A 818 31.805 1.043 75.304 1.00 22.08 ATOM 1093 C PHE A 818 31.696 2.467 75.884 1.0021.29 ATOM 1094 O PHE A 818 31.920 3.460 75.180 1.00 20.03 ATOM 1095 CB PHE A 818 30.406 0.528 75.002 1.00 23.06 ATOM 1096 CG PHE A 818 29.513 1.549 74.373 1.00 22.01 ATOM 1097 CD1 PHE A 818 29.678 1.914 73.040 1.00 22.32 ATOM 1098 CD2 PHE A 818 28.5142.156 75.124 1.00 23.62 ATOM 1099 CE1 PHE A 818 28.852 2.869 72.467 1.00 27.65 ATOM 1100 CE2 PHE A 818 27.681 3.116 74.558 1.00 28.88 ATOM 1101 CZ PHE A 818 27.852 3.471 73.231 1.00 22.16 ATOM 1102 N LEU A 819 31.323 2.556 77.154 1.00 21.31 ATOM 1103 CALEU A 819 31.164 3.857 77.812 1.00 23.49 ATOM 1104 C LEU A 819 32.445 4.699 77.808 1.00 26.91 ATOM 1105 O LEU A 819 32.394 5.907 77.557 1.00 20.81 ATOM 1106 CB LEU A 819 30.640 3.655 79.238 1.00 24.50 ATOM 1107 CG LEU A 819 29.199 3.116 79.294 1.00 23.57ATOM 1108 CD1 LEU A 819 28.780 2.812 80.728 1.00 22.54 ATOM 1109 CD2 LEU A 819 28.256 4.174 78.693 1.00 27.51 ATOM 1124 N LYS A 822 33.403 5.748 74.210 1.00 22.26 ATOM 1125 CA LYS A 822 32.595 6.856 73.684 1.00 21.99 ATOM 1126 C LYS A 822 33.157 8.20874.120 1.00 23.71 ATOM 1127 O LYS A 822 33.125 9.182 73.359 1.00 20.06 ATOM 1128 CB LYS A 822 31.123 6.713 74.115 1.00 24.02 ATOM 1129 CG LYS A 822 30.164 7.608 73.337 1.00 31.07 ATOM 1130 CD LYS A 822 28.727 7.077 73.410 1.00 38.28 ATOM 1131 CE LYS A822 28.155 7.091 74.822 1.00 39.48 ATOM 1132 NZ LYS A 822 27.958 8.479 75.331 1.00 42.42 RARgamma Site II Residues (ref. 2LBD.pdb) (highlighted residues of SEQ ID NO:4) ATOM 110 N SER 194 33.462 12.139 105.047 1.00 21.53 ATOM 111 CA SER 194 32.239 12.265104.247 1.00 21.04 ATOM 112 C SER 194 31.924 13.712 103.899 1.00 21.80 ATOM 113 O SER 194 31.727 14.047 102.732 1.00 21.17 ATOM 114 CB SER 194 31.059 11.646 104.989 1.00 19.63 ATOM 115 OG SER 194 29.904 11.654 104.183 1.00 19.69 ATOM 116 H SER 194 33.43311.608 105.870 1.00 13.44

ATOM 117 HG SER 194 29.696 12.575 103.994 1.00 16.06 ATOM 118 N LYS 195 31.894 14.557 104.925 1.00 22.99 ATOM 119 CA LYS 195 31.614 15.981 104.797 1.00 22.87 ATOM 120 C LYS 195 32.642 16.707 103.958 1.00 22.28 ATOM 121 O LYS 195 32.278 17.511103.124 1.00 23.38 ATOM 122 CB LYS 195 31.496 16.626 106.180 1.00 23.64 ATOM 123 CG LYS 195 30.078 16.572 106.747 1.00 28.29 ATOM 124 CD LYS 195 29.209 15.582 105.952 1.00 30.25 ATOM 125 CE LYS 195 27.736 15.623 106.362 1.00 32.32 ATOM 126 NZ LYS 19527.053 16.905 105.983 1.00 33.22 ATOM 127 H LYS 195 32.099 14.210 105.821 1.00 12.80 ATOM 128 1 HZ LYS 195 27.088 17.060 104.958 1.00 15.82 ATOM 129 2 HZ LYS 195 26.063 16.878 106.305 1.00 15.26 ATOM 130 3 HZ LYS 195 27.530 17.695 106.469 1.00 11.80 ATOM131 N ALA 196 33.923 16.430 104.165 1.00 21.84 ATOM 132 CA ALA 196 34.952 17.086 103.377 1.00 21.79 ATOM 133 C ALA 196 34.725 16.717 101.913 1.00 21.34 ATOM 134 O ALA 196 34.829 17.563 101.024 1.00 23.62 ATOM 135 CB ALA 196 36.347 16.659 103.841 1.0020.88 ATOM 136 H ALA 196 34.178 15.781 104.855 1.00 21.01 ATOM 137 N HIS 197 34.378 15.465 101.645 1.00 20.81 ATOM 138 CA HIS 197 34.128 15.073 100.265 1.00 20.38 ATOM 139 C HIS 197 32.896 15.796 99.701 1.00 21.21 ATOM 140 O HIS 197 32.952 16.388 98.6211.00 22.59 ATOM 141 CB HIS 197 33.968 13.568 100.113 1.00 18.26 ATOM 142 CG HIS 197 33.600 13.156 98.727 1.00 19.16 ATOM 143 ND1 HIS 197 34.524 13.060 97.706 1.00 19.65 ATOM 144 CD2 HIS 197 32.406 12.825 98.183 1.00 17.84 ATOM 145 CE1 HIS 197 33.91712.682 96.598 1.00 18.43 ATOM 146 NE2 HIS 197 32.633 12.531 96.862 1.00 20.25 ATOM 147 H HIS 197 34.300 14.821 102.382 1.00 16.92 ATOM 148 HD1 HIS 197 35.497 13.235 97.727 1.00 15.58 ATOM 149 HE2 HIS 197 31.936 12.266 96.223 1.00 12.28 ATOM 150 N GLN 19831.791 15.775 100.427 1.00 21.25 ATOM 151 CA GLN 198 30.600 16.434 99.941 1.00 23.59 ATOM 152 C GLN 198 30.828 17.916 99.658 1.00 24.07 ATOM 153 O GLN 198 30.421 18.441 98.617 1.00 25.03 ATOM 154 CB GLN 198 29.500 16.304 100.961 1.00 26.42 ATOM 155 CGGLN 198 28.782 14.985 100.984 1.00 29.27 ATOM 156 CD GLN 198 27.891 14.931 102.190 1.00 30.05 ATOM 157 OE1 GLN 198 27.411 15.972 102.653 1.00 31.98 ATOM 158 NE2 GLN 198 27.736 13.745 102.771 1.00 31.27 ATOM 159 H GLN 198 31.789 15.330 101.298 1.00 16.00ATOM 160 1HE2 GLN 198 27.144 13.729 103.551 1.00 15.85 ATOM 161 2HE2 GLN 198 28.203 12.971 102.398 1.00 16.16 ATOM 162 N GLU 199 31.470 18.584 100.606 1.00 25.01 ATOM 163 CA GLU 199 31.773 20.002 100.512 1.00 24.53 ATOM 164 C GLU 199 32.720 20.377 99.4001.00 23.37 ATOM 165 O GLU 199 32.675 21.495 98.934 1.00 24.39 ATOM 166 CB GLU 199 32.301 20.506 101.837 1.00 24.38 ATOM 167 CG GLU 199 31.213 20.542 102.874 1.00 27.91 ATOM 168 CD GLU 199 31.673 21.119 104.186 1.00 29.06 ATOM 169 OE1 GLU 199 32.49622.065 104.169 1.00 30.26 ATOM 170 OE2 GLU 199 31.194 20.639 105.238 1.00 32.53 ATOM 171 H GLU 199 31.753 18.106 101.411 1.00 12.27 ATOM 172 N THR 200 33.561 19.449 98.960 1.00 21.99 ATOM 173 CA THR 200 34.505 19.726 97.877 1.00 20.58 ATOM 174 C THR 20034.103 19.054 96.553 1.00 19.62 ATOM 175 O THR 200 34.807 19.163 95.548 1.00 17.71 ATOM 176 CB THR 200 35.934 19.275 98.260 1.00 20.42 ATOM 177 OG1 THR 200 36.007 17.835 98.247 1.00 17.20 ATOM 178 CG2 THR 200 36.299 19.831 99.658 1.00 18.24 ATOM 179 HTHR 200 33.574 18.555 99.363 1.00 15.26 ATOM 180 HG1 THR 200 35.526 17.536 99.027 1.00 18.31 ATOM 181 N PHE 201 32.993 18.328 96.561 1.00 20.00 ATOM 182 CA PHE 201 32.535 17.665 95.354 1.00 21.05 ATOM 183 C PHE 201 31.047 17.393 95.340 1.00 21.47 ATOM184 O PHE 201 30.604 16.377 95.848 1.00 22.07 ATOM 185 CB PHE 201 33.245 16.338 95.183 1.00 22.20 ATOM 186 CG PHE 201 33.122 15.769 93.814 1.00 21.15 ATOM 187 CD1 PHE 201 33.696 16.424 92.727 1.00 24.07 ATOM 188 CD2 PHE 201 32.499 14.558 93.610 1.0023.24 ATOM 189 CE1 PHE 201 33.660 15.871 91.458 1.00 23.53 ATOM 190 CE2 PHE 201 32.454 13.993 92.347 1.00 21.82 ATOM 191 CZ PHE 201 33.041 14.655 91.268 1.00 22.68 ATOM 192 H PHE 201 32.482 18.197 97.386 1.00 15.60 ATOM 193 N PRO 202 30.269 18.25694.680 1.00 23.56 ATOM 194 CA PRO 202 28.812 18.163 94.548 1.00 23.81 ATOM 195 C PRO 202 28.400 16.880 93.861 1.00 24.15 ATOM 196 O PRO 202 29.039 16.462 92.888 1.00 23.02 ATOM 197 CB PRO 202 28.485 19.348 93.655 1.00 23.88 ATOM 198 CG PRO 202 29.47520.339 94.055 1.00 25.50 ATOM 199 CD PRO 202 30.750 19.528 94.119 1.00 24.92 ATOM 496 N LEU 233 38.159 23.558 84.412 1.00 13.93 ATOM 497 CA LEU 233 37.402 22.729 85.345 1.00 13.81 ATOM 498 C LEU 233 38.315 21.721 86.032 1.00 13.48 ATOM 499 O LEU 23338.108 21.387 87.192 1.00 15.95 ATOM 500 CB LEU 233 36.250 22.001 84.634 1.00 12.25 ATOM 501 CG LEU 233 35.083 22.858 84.105 1.00 12.32 ATOM 502 CD1 LEU 233 34.147 21.981 83.337 1.00 12.38 ATOM 503 CD2 LEU 233 34.336 23.557 85.223 1.00 13.65 ATOM 504 HLEU 233 37.941 23.494 83.454 1.00 14.66 ATOM 505 N ALA 234 39.324 21.233 85.327 1.00 12.52 ATOM 506 CA ALA 234 40.243 20.291 85.935 1.00 14.87 ATOM 507 C ALA 234 41.085 21.048 86.995 1.00 16.06 ATOM 508 O ALA 234 41.209 20.596 88.141 1.00 15.82 ATOM 509CB ALA 234 41.133 19.635 84.876 1.00 13.08 ATOM 510 H ALA 234 39.421 21.484 84.388 1.00 18.02 ATOM 546 N CYS 237 39.285 21.662 90.004 1.00 14.60 ATOM 547 CA CYS 237 39.063 20.411 90.679 1.00 16.39 ATOM 548 C CYS 237 40.287 20.070 91.534 1.00 16.47 ATOM549 O CYS 237 40.160 19.703 92.703 1.00 17.24 ATOM 550 CB CYS 237 38.720 19.278 89.708 1.00 14.97 ATOM 551 SG CYS 237 37.905 17.917 90.622 1.00 17.49 ATOM 552 H CYS 237 39.424 21.679 89.042 1.00 13.36 ATOM 553 N ILE 238 41.477 20.237 90.969 1.00 15.33ATOM 554 CA ILE 238 42.705 19.945 91.699 1.00 13.85 ATOM 555 C ILE 238 42.774 20.741 93.007 1.00 14.22 ATOM 556 O ILE 238 43.224 20.252 94.044 1.00 14.79 ATOM 557 CB ILE 238 43.889 20.245 90.810 1.00 13.01 ATOM 558 CG1 ILE 238 43.899 19.259 89.634 1.0012.70 ATOM 559 CG2 ILE 238 45.188 20.219 91.616 1.00 14.88 ATOM 560 CD1 ILE 238 44.860 19.636 88.559 1.00 10.75 ATOM 561 H ILE 238 41.538 20.554 90.045 1.00 16.76 ATOM 562 N ILE 239 42.358 21.990 92.940 1.00 14.17 ATOM 563 CA ILE 239 42.329 22.858 94.1071.00 14.19 ATOM 564 C ILE 239 41.325 22.268 95.102 1.00 14.54 ATOM 565 O ILE 239 41.582 22.238 96.299 1.00 14.16 ATOM 566 CB ILE 239 41.910 24.293 93.703 1.00 14.59 ATOM 567 CG1 ILE 239 43.095 25.050 93.099 1.00 13.80 ATOM 568 CG2 ILE 239 41.339 25.02494.871 1.00 15.96 ATOM 569 CD1 ILE 239 42.680 26.334 92.386 1.00 13.34 ATOM 570 H ILE 239 42.056 22.353 92.079 1.00 18.53 ATOM 571 N LYS 240 40.201 21.764 94.615 1.00 15.39 ATOM 572 CA LYS 240 39.220 21.175 95.515 1.00 15.53 ATOM 573 C LYS 240 39.71819.879 96.140 1.00 15.65 ATOM 574 O LYS 240 39.295 19.531 97.244 1.00 13.48 ATOM 575 CB LYS 240 37.885 20.951 94.810 1.00 18.27 ATOM 576 CG LYS 240 37.099 22.226 94.594 1.00 21.05 ATOM 577 CD LYS 240 36.331 22.615 95.838 1.00 23.72 ATOM 578 CE LYS 24036.215 24.137 96.000 1.00 27.33 ATOM 579 NZ LYS 240 37.448 24.762 96.648 1.00 30.09 ATOM 580 H LYS 240 39.995 21.825 93.653 1.00 14.20 ATOM 581 1HZ LYS 240 37.590 24.341 97.587 1.00 18.02 ATOM 582 2HZ LYS 240 38.287 24.568 96.066 1.00 14.97 ATOM 583 3HZLYS 240 37.322 25.789 96.751 1.00 16.98 ATOM 584 N ILE 241 40.619 19.179 95.447 1.00 14.37 ATOM 585 CA ILE 241 41.183 17.934 95.962 1.00 15.71 ATOM 586 C ILE 241 42.175 18.268 97.083 1.00 16.21 ATOM 587 O ILE 241 42.213 17.598 98.123 1.00 15.85 ATOM 588CB ILE 241 41.852 17.092 94.849 1.00 15.46 ATOM 589 CG1 ILE 241 40.770 16.452 93.981 1.00 16.06 ATOM 590 CG2 ILE 241 42.699 15.981 95.448 1.00 17.68 ATOM 591 CD1 ILE 241 41.249 15.771 92.705 1.00 17.03 ATOM 592 H ILE 241 40.882 19.507 94.561 1.00 16.01ATOM 593 N VAL 242 42.955 19.330 96.874 1.00 17.19 ATOM 594 CA VAL 242 43.919 19.797 97.869 1.00 16.87 ATOM 595 C VAL 242 43.155 20.219 99.116 1.00 16.56 ATOM 596 O VAL 242 43.539 19.863 100.225 1.00 16.69 ATOM 597 CB VAL 242 44.756 20.963 97.348 1.0015.52 ATOM 598 CG1 VAL 242 45.481 21.614 98.481 1.00 15.69 ATOM 599 CG2 VAL 242 45.739 20.461 96.299 1.00 16.20 ATOM 600 H VAL 242 42.885 19.801 96.014 1.00 17.48 ATOM 601 N GLU 243 42.046 20.930 98.929 1.00 16.45 ATOM 602 CA GLU 243 41.213 21.338100.062 1.00 19.31 ATOM 603 C GLU 243 40.680 20.112 100.818 1.00 17.64 ATOM 604 O GLU 243 40.579 20.125 102.024 1.00 14.49 ATOM 605 CB GLU 243 40.013 22.160 99.601 1.00 22.56 ATOM 606 CG GLU 243 39.152 22.517 100.780 1.00 27.44 ATOM 607 CD GLU 243 37.78123.001 100.416 1.00 31.18 ATOM 608 OE1 GLU 243 37.679 23.810 99.463 1.00 33.07 ATOM 609 OE2 GLU 243 36.810 22.586 101.109 1.00 33.67 ATOM 610 H GLU 243 41.792 21.201 98.022 1.00 15.45 ATOM 611 N PHE 244 40.256 19.100 100.064 1.00 18.29 ATOM 612 CA PHE244 39.743 17.837 100.600 1.00 16.37 ATOM 613 C PHE 244 40.842 17.147 101.406 1.00 15.24 ATOM 614 O PHE 244 40.595 16.721 102.531 1.00 15.07 ATOM 615 CB PHE 244 39.277 16.927 99.452 1.00 17.51 ATOM 616 CG PHE 244 38.981 15.503 99.858 1.00 14.72 ATOM 617CD1 PHE 244 37.831 15.187 100.549 1.00 15.04 ATOM 618 CD2 PHE 244 39.845 14.479 99.500 1.00 15.96 ATOM 619 CE1 PHE 244 37.540 13.862 100.880 1.00 16.72 ATOM 620 CE2 PHE 244 39.565 13.154 99.823 1.00 16.27 ATOM 621 CZ PHE 244 38.405 12.845 100.518 1.0014.78 ATOM 622 H PHE 244 40.258 19.205 99.089 1.00 13.23 ATOM 814 N ALA 266 48.576 10.971 93.812 1.00 15.90 ATOM 815 CA ALA 266 47.182 10.496 93.792 1.00 17.39 ATOM 816 C ALA 266 46.167 11.428 93.127 1.00 17.22 ATOM 817 O ALA 266 45.012 11.043 92.9031.00 16.41 ATOM 818 CB ALA 266 46.722 10.185 95.222 1.00 16.38 ATOM 819 H ALA 266 48.811 11.745 94.370 1.00 15.48 ATOM 820 N CYS 267 46.597 12.643 92.802 1.00 15.91 ATOM 821 CA CYS 267 45.700 13.622 92.214 1.00 17.69 ATOM 822 C CYS 267 44.940 13.17190.958 1.00 16.15 ATOM 823 O CYS 267 43.718 13.343 90.888 1.00 14.43 ATOM 824 CB CYS 267 46.438 14.920 91.951 1.00 18.90 ATOM 825 SG CYS 267 45.310 16.241 91.678 1.00 23.66 ATOM 826 H CYS 267 47.530 12.902 92.957 1.00 11.70 ATOM 827 N LEU 268 45.65012.573 89.999 1.00 14.38 ATOM 828 CA LEU 268 45.009 12.091 88.787 1.00 15.09 ATOM 829 C LEU 268 44.049 10.961 89.129 1.00 15.22 ATOM 830 O LEU 268 42.932 10.926 88.602 1.00 15.41 ATOM 831 CB LEU 268 46.037 11.609 87.758 1.00 14.82 ATOM 832 CG LEU 26845.922 12.104 86.291 1.00 16.13 ATOM 833 CD1 LEU 268 46.809 11.216 85.363 1.00 13.28 ATOM 834 CD2 LEU 268 44.465 12.106 85.808 1.00 13.62 ATOM 835 H LEU 268 46.624 12.472 90.107 1.00 11.61 ATOM 836 N ASP 269 44.475 10.032 89.989 1.00 14.39 ATOM 837 CAASP 269 43.610 8.927 90.390 1.00 14.73 ATOM 838 C ASP 269 42.264 9.494 90.826 1.00 16.42 ATOM 839 O ASP 269 41.214 9.159 90.250 1.00 17.01 ATOM 840 CB ASP 269 44.193 8.164 91.583 1.00 16.26 ATOM 841 CG ASP 269 45.461 7.396 91.251 1.00 16.52 ATOM 842 OD1ASP 269 46.050 7.627 90.207 1.00 18.78 ATOM 843 OD2 ASP 269 45.887 6.548 92.057 1.00 19.84 ATOM 844 H ASP 269 45.390 10.079 90.347 1.00 13.22 ATOM 845 N ILE 270 42.299 10.400 91.809 1.00 16.86 ATOM 846 CA ILE 270 41.069 10.996 92.356 1.00 16.75 ATOM 847C ILE 270 40.260 11.805 91.336 1.00 15.88 ATOM 848 O ILE 270 39.035 11.758 91.345 1.00 16.48 ATOM 849 CB ILE 270 41.351 11.838 93.625 1.00 16.55 ATOM 850 CG1 ILE 270 42.034 10.972 94.680 1.00 15.45 ATOM 851 CG2 ILE 270 40.046 12.388 94.221 1.00 16.85ATOM 852 CD1 ILE 270 42.364 11.741 95.933 1.00 18.34 ATOM 853 H ILE 270 43.171 10.675 92.167 1.00 13.31 ATOM 854 N LEU 271 40.932 12.535 90.458 1.00 15.65 ATOM 855 CA LEU 271 40.246 13.308 89.430 1.00 16.49 ATOM 856 C LEU 271 39.456 12.294 88.580 1.0016.41 ATOM 857 O LEU 271 38.294 12.530 88.244 1.00 17.42 ATOM 858 CB LEU 271 41.297 14.038 88.597 1.00 16.24 ATOM 859 CG LEU 271 41.309 15.557 88.415 1.00 17.43 ATOM 860 CD1 LEU 271 40.654 16.308 89.533 1.00 14.58 ATOM 861 CD2 LEU 271 42.735 16.00588.203 1.00 16.24 ATOM 862 H LEU 271 41.910 12.566 90.512 1.00 15.08 ATOM 863 N MET 272 40.060 11.131 88.316 1.00 16.60 ATOM 864 CA MET 272 39.418 10.073 87.528 1.00 16.79 ATOM 865 C MET 272 38.250 9.441 88.300 1.00 17.44 ATOM 866 O MET 272 37.176 9.16187.733 1.00 19.90 ATOM 867 CB MET 272 40.420 8.978 87.127 1.00 17.65 ATOM 868 CG MET 272 41.448 9.392 86.102 1.00 18.79 ATOM 869 SD MET 272 40.799 9.486 84.419 1.00 22.97 ATOM 870 CE MET 272 42.292 9.289 83.461 1.00 19.64 ATOM 871 H MET 272 40.96410.976 88.662 1.00 18.75 ATOM 872 N LEU 273 38.441 9.179 89.581 1.00 14.90 ATOM 873 CA LEU 273 37.356 8.606 90.339 1.00 14.87 ATOM 874 C LEU 273 36.185 9.588 90.339 1.00 15.34 ATOM 875 O LEU 273 35.037 9.194 90.129 1.00 15.36 ATOM 876 CB LEU 273 37.8098.343 91.761 1.00 15.48 ATOM 877 CG LEU 273 36.730 7.760 92.651 1.00 16.54 ATOM 878 CD1 LEU 273 36.312 6.404 92.086 1.00 17.29 ATOM 879 CD2 LEU 273 37.282 7.620 94.064 1.00 15.37 ATOM 880 H LEU 273 39.308 9.367 89.992 1.00 16.64 ATOM 881 N ARG 274 36.49410.873 90.528 1.00 15.34 ATOM 882 CA ARG 274 35.486 11.919 90.572 1.00 15.78 ATOM 883 C ARG 274 34.629 12.006 89.328 1.00 17.06 ATOM 884 O ARG 274 33.434 11.812 89.437 1.00 18.66 ATOM 885 CB ARG 274 36.095 13.267 90.936 1.00 16.75 ATOM 886 CG ARG 27436.461 13.333 92.429 1.00 17.30 ATOM 887 CD ARG 274 36.835 14.716 92.892 1.00 17.86 ATOM 888 NE ARG 274 36.951 14.740 94.351 1.00 21.93 ATOM 889 CZ ARG 274 37.027 15.844 95.093 1.00 22.23

ATOM 890 NH1 ARG 274 36.998 17.045 94.520 1.00 21.99 ATOM 891 NH2 ARG 274 37.115 15.745 96.413 1.00 20.01 ATOM 892 H ARG 274 37.434 11.117 90.631 1.00 16.07 ATOM 893 HE ARG 274 36.978 13.875 94.802 1.00 14.88 ATOM 894 1HH1 ARG 274 36.923 17.13493.527 1.00 14.06 ATOM 895 2HH1 ARG 274 37.061 17.866 95.089 1.00 14.03 ATOM 896 1HH2 ARG 274 37.122 14.847 96.850 1.00 17.31 ATOM 897 2HH2 ARG 274 37.173 16.572 96.971 1.00 14.92 ATOM 914 N THR 277 32.271 9.023 88.779 1.00 13.95 ATOM 915 CA THR 27731.115 8.905 89.661 1.00 15.92 ATOM 916 C THR 277 30.004 9.856 89.186 1.00 17.31 ATOM 917 O THR 277 28.859 9.761 89.626 1.00 19.20 ATOM 918 CB THR 277 31.471 9.205 91.138 1.00 18.17 ATOM 919 OG1 THR 277 31.879 10.567 91.267 1.00 20.50 ATOM 920 CG2 THR277 32.613 8.315 91.605 1.00 19.00 ATOM 921 H THR 277 33.002 9.624 89.038 1.00 16.11 ATOM 922 HG1 THR 277 32.699 10.722 90.788 1.00 14.03 ATOM 923 N ARG 278 30.352 10.756 88.266 1.00 17.51 ATOM 924 CA ARG 278 29.428 11.741 87.669 1.00 17.48 ATOM 925 CARG 278 28.907 11.260 86.280 1.00 16.92 ATOM 926 O ARG 278 28.552 12.046 85.396 1.00 16.64 ATOM 927 CB ARG 278 30.176 13.060 87.508 1.00 17.18 ATOM 928 CG ARG 278 30.446 13.774 88.808 1.00 16.64 ATOM 929 CD ARG 278 29.338 14.762 89.057 1.00 17.73 ATOM930 NE ARG 278 29.640 15.725 90.108 1.00 17.21 ATOM 931 CZ ARG 278 30.658 16.570 90.085 1.00 19.13 ATOM 932 NH1 ARG 278 31.499 16.576 89.060 1.00 20.62 ATOM 933 NH2 ARG 278 30.816 17.433 91.081 1.00 20.16 ATOM 934 H ARG 278 31.277 10.787 87.949 1.00