Easy To Use Patents Search & Patent Lawyer Directory

At Patents you can conduct a Patent Search, File a Patent Application, find a Patent Attorney, or search available technology through our Patent Exchange. Patents are available using simple keyword or date criteria. If you are looking to hire a patent attorney, you've come to the right place. Protect your idea and hire a patent lawyer.

Searching:





Search by keyword, patent number, inventor, assignee, city or state:




Patent # Description
2018/0015142 THERAPEUTIC AND PROPHYLACTIC METHODS, USES AND COMPOSITIONS COMPRISING ANEXIN A5
The present invention provides a method for the prevention and/or reduction of peri- or postoperative complications following surgical intervention, such as...
2018/0015141 Use of PRG4 as an Anti-Inflammatory Agent
Disclosed herein are methods of using PRG4 glycoprotein, also known as lubricin, to reduce, inhibit, or down-regulate pro-inflammatory pathways in patients at...
2018/0015140 VASOPRESSIN FORMULATIONS FOR USE IN TREATMENT OF HYPOTENSION
Provided herein are peptide formulations comprising polymers as stabilizing agents. The peptide formulations can be more stable for prolonged periods of time...
2018/0015139 Low-Dose Stable Formulations of Linaclotide
The present invention relates to stable pharmaceutical compositions comprising linaclotide or pharmaceutically acceptable salts thereof, as well as to various...
2018/0015138 RECOVERY AND PROCESSING OF HUMAN EMBRYOS FORMED IN VIVO
A kit having instructions for use for performing uterine lavage in a female patient includes a uterine lavage catheter configured for insertion into a woman's...
2018/0015137 ANTI-SENESCENCE COMPOUNDS AND USES THEREOF
The invention relates to a peptide comprising the amino acid sequence LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence...
2018/0015136 THERAPEUTIC HOMODIMER AND USES THEREOF
The invention relates to therapeutic peptides and uses thereof. In particular, the invention relates to disulphide-linked homodimers useful in the treatment or...
2018/0015135 METHODS AND COMPOSITIONS FOR MAINTAINING THE CONFORMATION AND STRUCTURAL INTEGRITY OF BIOMOLECULES
A composition includes a target pharmaceutical or biological agent, a solution containing the target pharmaceutical or biological agent, and substrate that is...
2018/0015134 COMPOSITION FOR INCREASING EXERCISE PERFORMANCE ABILITY AND ENHANCING PHYSICAL STRENGTH, CONTAINING COMPOSITE...
The present invention relates to a pharmaceutical composition and a nutraceutical composition containing a composite extract of Allium sativum, Capsicum...
2018/0015133 TOPICAL FORMULATION FOR PROMOTING WOUND HEALING
The present invention provides a topical formulation comprising an active agent, which comprises salvigenin and optionally asiaticoside. The present invention...
2018/0015132 METHOD FOR TREATMENT AND PREVENTION OF KIDNEY DISEASES WITH LOTUS SEEDPOD EXTRACT
Provided is a method for treatment and prevention of kidney disease with a composition, wherein the composition comprises a lotus seedpod extract.
2018/0015131 TREATMENT OF CANCER BY MANIPULATION OF COMMENSAL MICROFLORA
Provided herein are methods of treatment and/or prevention of cancer by manipulation of commensal microflora. In particular, the amount, identity, presence,...
2018/0015130 PROBIOTIC COMPOSITIONS CONTAINING CLOSTRIDIALES FOR INHIBITING INFLAMMATION
Pharmaceutical compositions containing microbial entities are described herein. The pharmaceutical compositions may optionally contain or be used in...
2018/0015129 TREATMENT OF RETINAL VASCULAR DISEASE USING PROGENITOR CELLS
Methods and compositions for treating ophthalmic disease, reducing retinal neovascularization and retinal vascular leakage using progenitor cells, such as...
2018/0015128 Amniotic Fluid-Derived Preparation with a Standardized Biologic Activity
This invention relates to preparations derived from amniotic fluid, and more specifically, to an amniotic fluid preparation with specific standardized measure...
2018/0015126 GENERATION OF UNIFORM HEPATOCYTES FROM HUMAN EMBRYONIC STEM CELLS BY INHIBITING TGF-BETA and METHODS OF...
This disclosure relates generally to new methods of maintaining the expression of hepatic genes in human hepatocytes and method for maintaining the functional...
2018/0015125 USE OF ADHERENT STROMAL CELLS FOR ENHANCING HEMATOPOIESIS IN A SUBJECT IN NEED THEREOF
Disclosed herein are methods and compositions comprising adherent stromal cells.
2018/0015124 Adult Stem Cells/Progenitor Cells and Stem Cell Proteins for Treatment of Eye Injuries and Diseases
The present invention encompasses methods and compositions for treating an ocular disease, disorder or condition in a mammal. The invention includes a...
2018/0015123 METHOD FOR MASS PRODUCING NATURAL KILLER CELL AND USE OF NATURAL KILLER CELL OBTAINED BY THE METHOD AS...
The present invention relates to a method for producing a large amount of natural killer cells and the use of natural killer cells obtained by the method as an...
2018/0015122 PHARMACEUTICAL COMPOSITION EFFECTIVE IN PREVENTING ADVERSE EFFECTS ASSOCIATED WITH THE USE OF GLUCOCORTICOIDS
The present invention relates to pharmaceutical compositions comprising combinations of amino acids, vitamins, and minerals, which prevent the occurrence of...
2018/0015121 PROTON-BINDING POLYMERS FOR ORAL ADMINISTRATION
Pharmaceutical compositions for and methods of treating an animal, including a human, and methods of preparing such compositions. The pharmaceutical...
2018/0015120 Self-assembling monomers and oligomers as surface-modifying endgroups for polymers
Polymers having the formula R(LE).sub.x wherein R is a polymeric core having a number average molecular weight of from 5000 to 7,000,000 daltons and having x...
2018/0015119 PROCESS FOR GRANULATING SEVELAMER CARBONATE
The present disclosure provides a pharmaceutical composition comprising of a polyallylamine polymer or pharmaceutically acceptable salts thereof; excipient...
2018/0015118 METHODS OF TREATING UPPER GASTROINTESTINAL DISORDERS IN PPI REFRACTORY GERD
Disclosed herein are oral dosage forms of colesevelam, or a pharmaceutically acceptable salt thereof, adapted to treat upper gastro-intestinal disorders...
2018/0015117 METHOD FOR PREVENTION OF COLECTOMY
A method of treating chronic active ulcerative colitis in a subject that is refractory or responds insufficiently or is intolerant to anti-inflammatory...
2018/0015116 CFTR MRNA COMPOSITIONS AND RELATED METHODS AND USES
Materials, formulations, production methods, and methods for delivery of CFTR mRNA for induction of CFTR expression, including in the mammalian lung are...
2018/0015115 RESTORING PHYSIOLOGY WITH SMALL MOLECULE MIMICS OF MISSING PROTEINS
Disclosed are methods for treating a disease or condition characterized by decreased expression or reduced function of an ion channel, comprising administering...
2018/0015114 STIMULATION OF AN IMMUNE RESPONSE BY ENANTIOMERS OF CATIONIC LIPIDS
A composition and method for activating immune cells ex-vivo, or inducing an immune response in a subject including a composition comprising at least one...
2018/0015113 Phospholipid Ether Analogs for Imaging and Targeted Treatment of Pediatric Solid Tumors
It is disclosed herein that that certain alkylphosphocholine analogs are preferentially taken up by malignant pediatric tumor cells. The alkylphophocholine...
2018/0015112 COMPOSITIONS FOR ORAL ADMINISTRATION OF ZOLEDRONIC ACID OR RELATED COMPOUNDS FOR TREATING COMPLEX REGIONAL PAIN...
Oral dosage forms of osteoclast inhibitors, such as zoledronic acid, in an acid or a salt form can be used to treat or alleviate pain or related conditions,...
2018/0015111 METHODS FOR ON DEMAND PRE-EXPOSURE PROPHYLACTIC TREATMENT OF HIV INFECTION
The present invention relates to methods for on demand pre-exposure prophylactic treatment of HIV infection. In particular, the present invention relates to a...
2018/0015110 OSTEOCLAST INHIBITORS FOR JOINT CONDITIONS
Oral dosage forms of osteoclast inhibitors, such as neridronic acid and zoledronic acid, in an acid or a salt form can be used to treat or alleviate pain or...
2018/0015109 METHODS AND COMPOSITIONS FOR IMPROVING COGNITIVE FUNCTION
The invention relates to methods and compositions for improving cognitive function by using a combination of a synaptic vesicle protein 2A (SV2A) inhibitor and...
2018/0015108 MINOCYCLINE COMPOUNDS AND METHODS OF USE THEREOF
Methods and compositions for using a tetracycline compound to treat bacterial infections are described. In one embodiment, for example, the invention provides...
2018/0015107 USE OF HOMOSALATE AND OCTYL SALICYLATE TO TREAT MULTIPLE SCLEROSIS
A method of treating an MS patient with homosalate, octyl salicylate, or a combination is disclosed.
2018/0015106 PREPARATION AND USE OF 7A-HETEROCYCLE SUBSTITUTED- 6,6-DIFLUORO BICYCLIC HIMBACINE DERIVATIVES AS PAR-1...
The present invention relates to bicyclic himbacine derivatives of the formula ##STR00001## or a pharmaceutically acceptable salt thereof wherein: R.sup.1 is ...
2018/0015105 FORMULATIONS OF DEOXYCHOLIC ACID AND SALTS THEREOF
The present application is directed to an aqueous pharmaceutical composition comprising from about 0.4% w/v to less than about 2% w/v of a salt of deoxycholic...
2018/0015104 NON-HORMONAL STEROID MODULATORS OF NF-kB FOR TREATMENT OF DISEASE
The present invention relates to compounds and methods which may be useful as treatments of neuromuscular diseases such as muscular dystrophy, and as...
2018/0015103 STEROID COMPOUND FOR USE IN THE TREATMENT OF HEPATIC ENCEPHALOPATHY
The present invention provides the steroidal compound 3.alpha.-ethynyl-3.beta.-hydroxyandrostan-17-one oxime, or a pharmaceutically acceptable salt thereof,...
2018/0015102 Oral Transmucosal Drug Delivery System
This invention relates to dosage forms for the delivery of drugs across the oral mucosa having improved transmucosal permeability. More specifically, the...
2018/0015101 COMPOSITIONS AND METHODS FOR ANTIGEN-SPECIFIC TOLERANCE
The invention is in the field of immunotherapy. More particularly, the invention provides a composition comprising a Heme Oxygenase-1 (HO-1) and antigens. Also...
2018/0015100 COMBINATION PRODUCTS FOR THE TREATMENT OF BACTERIAL INFECTIONS AND METHODS OF PRODUCING OR DOSING OF SAME
Provided herein are methods of treating a bacterial infection, wherein the methods comprise administering (a) ceftibuten or a pharmaceutically acceptable salt...
2018/0015099 IMIDAZOPYRIDINE COMPOUNDS AND USES THEREOF
This invention generally relates to substituted imidazopyridine compounds, particularly substituted 4-(imidazo[1,2-a]pyridin-2-yl)benzamide compounds and salts...
2018/0015098 APILIMOD COMPOSITIONS AND METHODS FOR USING SAME
The present invention relates to methods for treating Charcot-Marie-Tooth Disease (CMT) with apilimod and related compositions and methods.
2018/0015097 CYCLOHEXYLAMINE DERIVATIVES HAVING 2 ADRENERGIC AGONIST AND M3 MUSCARINIC ANTAGONIST ACTIVITIES
The present invention relates to novel compounds having .beta.2 adrenergic agonist and M3 muscarinic antagonist dual activity, to pharmaceutical compositions...
2018/0015096 HIGHLY ACTIVE ANTI-NEOPLASTIC AND ANTI-PROLIFERATIVE AGENTS
This invention is in the area of improved compounds and methods for treating selected cancers and hyperproliferative disorders.
2018/0015095 NUCLEOTIDE ANALOGS
Disclosed herein, inter alia, are acyclic nucleotide analogs and methods of using an acyclic nucleotide analog for treating and/or ameliorating a ...
2018/0015094 TREATMENT OF CROHN'S DISEASE WITH DELAYED-RELEASE 6-MERCAPTOPURINE
Methods of treating patients suffering from Crohn's disease or ulcerative colitis who did not experience a clinical response to previous thiopurine ...
2018/0015093 TREATMENT OF CANCERS USING PI3 KINASE ISOFORM MODULATORS
Provided herein are methods, kits, and pharmaceutical compositions that include a PI3 kinase inhibitor for treating cancers or hematologic disorders.
2018/0015092 PHARMACEUTICAL COMBINATIONS
The disclosure relates to a pharmaceutical combination of a mdm2/4 inhibitor, namely ...
← Previous | 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 | Next →

File A Patent Application

  • Protect your idea -- Don't let someone else file first. Learn more.

  • 3 Easy Steps -- Complete Form, application Review, and File. See our process.

  • Attorney Review -- Have your application reviewed by a Patent Attorney. See what's included.