---

Register or Login To Download This Patent As A PDF

United States Patent Application	20090089888
Kind Code	A1
Zuker; Charles ;   et al.	April 2, 2009

---

---

---

Goverment Interests

---

STATEMENT OF GOVERNMENT SUPPORT

[0002]This invention was partially supported by grant NIH R01 DC04861. The United States government may have certain rights in the invention.

---

Claims

---

1. A method of identifying a compound that binds to or modulates an activity of a polycystin 1-like 3 (PC-1-L3) taste receptor polypeptide, or a polycystin-2-like 1(PC-2-L1)/PC-1-L3 polypeptide complex, the method comprising:(a.) contacting a biological or biochemical sample comprising the PC-1-L3 taste receptor polypeptide or PC-2-L1/PC-1-L3 polypeptide complex with a test compound; and,(b.) detecting binding of the test compound to the PC-1-L3 taste receptor polypeptide or PC-2-L1/PC-1-L3 polypeptide complex, or modulation of the activity of the polypeptide or polypeptide complex by the test compound, thereby identifying the compound that binds to or modulates the activity of the PC-1-L3 taste receptor polypeptide or PC-2-L1/PC-1-L3 polypeptide complex.

2-3. (canceled)

4. The method of claim 1, wherein (a.) comprises contacting one or more biological sample comprising one or more PC-1-L3 taste receptor polypeptide or PC-2-L1/PC-1-L3 polypeptide complex with a plurality of test compounds and wherein (b.) comprises detecting binding of the test compounds to the PC-1-L3 taste receptor polypeptide or PC-2-L1/PC-1-L3 polypeptide complex, or modulation of the activity of the polypeptide by the test compounds, thereby identifying one or more compound that binds to or modulates the activity of the PC-1-L3 taste receptor polypeptide or PC-2-L1/PC-1-L3 polypeptide complex.

5. The method of claim 1, wherein the polypeptide complex is a taste receptor polypeptide complex.

6. The method of claim 1, wherein the PC-1-L3) taste receptor polypeptide, or a polycystin-2-like 1(PC-2-L1)/PC-1-L3 polypeptide complex is a component of an acid sensing, pH sensing, or sour tastant sensing receptor.

7. (canceled)

8. The method of claim 1, wherein the test compound is selected from the group consisting of: naturally occurring compounds, ions, sour tastants, small organic molecules, peptides, peptide mimetics, an acid, a weak acid, CO, CO.sub.2, acetic acid, a specific blocker of carbonic anhydrase, MK-417, an ion channel agonist, an ion channel antagonist, an ion channel enhancer, a non-specific Ca.sup.+ channel blocker, Nifedipine and structurally related compounds, Verapamil and structurally related compounds, gadolinium and structurally related compounds, and a stretch-induced channel blocker.

9. The method of claim 1, wherein the test compound enhances an activity of the PC-1-L3 taste receptor polypeptide or PC-2-L1/PC-1-L3 polypeptide complex.

10. The method of claim 1, wherein the test compound potentiates an activity of the PC-1-L3 taste receptor polypeptide or PC-2-L1/PC-1-L3 polypeptide complex.

11. The method of claim 1, wherein the test compound inhibits or blocks an activity of the PC-1-L3 taste receptor polypeptide or PC-2-L1/PC-1-L3 polypeptide complex.

12. The method of claim 1, wherein the PC-1-L3 taste receptor polypeptide is a human PC-1-L3 taste receptor polypeptide, or wherein the PC-2-L1/PC-1-L3 complex is a human PC-2-L1/PC-1-L3 polypeptide complex.

13. The method of claim 1, wherein the PC-1-L3 taste receptor polypeptide is a murine PC-1-L3 taste receptor polypeptide or wherein the PC-2-L1/PC-1-L3 polypeptide complex is a murine PC-2-L1/PC-1-L3 complex.

14. (canceled)

15. The method of claim 1, wherein step (b.) includes detecting binding between the PC-1-L3 taste receptor polypeptide and a moiety selected from the group consisting of: a PC-2-L1 polypeptide, a potentiator of the PC-1-L3 taste receptor polypeptide, an antagonist of the PC-1-L3 taste receptor polypeptide, an agonist of the PC-1-L3 taste receptor polypeptide, an inverse agonist of the PC-1-L3 taste receptor polypeptide, a ligand that specifically binds to the PC-1-L3 taste receptor polypeptide, and an antibody that specifically binds to the PC-1-L3 taste receptor polypeptide.

16. The method of claim 1, wherein step (b.) includes detecting binding between the PC-2-L1/PC-1-L3 polypeptide complex and a moiety selected from the group consisting of: a potentiator of the complex, an antagonist of the complex, an agonist of the complex, an inverse agonist of the complex, a ligand that specifically binds to the complex, and an antibody that specifically binds to the complex.

17-20. (canceled)

21. The method of claim 1, wherein detecting binding of the test compound to the PC-1-L3 taste receptor polypeptide or the PC-2-L1/PC-1-L3 polypeptide complex, or activity of the test compound on the PC-1-L3 taste receptor polypeptide or the PC-2-L1/PC-1-L3 polypeptide complex comprises detecting one or more of: detecting binding between PC-2-L1 and PC-1-L3, formation or stability of the polypeptide complex, H.sup.+ flux, Na.sup.+ flux, Ca.sup.2+ flux, ion flux, changes in an activity of an intracellular pH or ion sensor, depolarization of the cell, cell membrane voltage changes, cell membrane conductivity changes, a kinase activity triggered upon binding of a compound to the PC-1-L3 taste receptor polypeptide, generation, breakdown or binding of a phorbol ester by the PC-1-L3 taste receptor polypeptide, binding of diacylglycerol or other lipids by the PC-1-L3 taste receptor polypeptide, cAMP activity, cGMP activity, GTPgammaS binding, phospholipase C activity, activity of an enzyme involved in cellular ionic balance, binding of PC-1-L3 to another PKD protein, or a transcriptional reporter activity.

22. The method of claim 1, further comprising recombinantly expressing a PKD1-L3 gene in a recombinant cell, or both a PKD1-L3 gene and a PKD2L1 gene in a recombinant cell, wherein the biological sample is derived from the recombinant cell.

23. The method of claim 22, wherein the PKD1-L3 gene, or the PKD1-L3 and the PKD2L1 gene is or are heterologous to the recombinant cell.

24-25. (canceled)

26. The method of claim 1, wherein the PC-1-L3 taste receptor polypeptide or the PC-2-L1/PC-1-L3 complex is incorporated into a biosensor.

27-35. (canceled)

36. A method of detecting a taste-induced behavior or physiological response modulated by a PC-1-L3 taste receptor polypeptide or PC-2-L1/PC-1-L3 taste receptor polypeptide complex, the method comprising:(a) introducing a heterologous PKD1-L3 taste receptor gene into an animal and expressing an encoded heterologous PC-1-L3 taste receptor polypeptide in a taste bud of the animal;(b) providing a putative taste receptor tastant or modulator to the animal; and,(c) monitoring a feeding behavior or physiological response of the animal in response to the presence of the putative taste receptor tastant or modulator.

37-52. (canceled)

53. A method of modulating an activity of a cell expressing a PC-2L1/PC-1L3 polypeptide complex, the method comprising contacting the cell with a compound that binds to or modulates an activity of the complex.

54-56. (canceled)

57. A recombinant cell comprising a heterologous PKD1-L3 gene and a heterologous PKD2-L1 gene.

58-62. (canceled)

63. An isolated or recombinant polypeptide complex comprising at least one of: a recombinant PC-1-L3 polypeptide or a recombinant polycystin 2-L1 polypeptide, the complex further comprising at least one of: a PC-1-L3 polypeptide, a polycystin 2-L1 polypeptide, a recombinant PC-1-L3 polypeptide or a recombinant polycystin 2-L1 polypeptide.

64-68. (canceled)

69. A knock out non-human animal comprising a defect in a native PKD1-L3 taste receptor gene or a defect in native PKD1-L3 gene expression.

70-81. (canceled)

---

Description

---

CROSS REFERENCE TO RELATED APPLICATIONS

[0001]This application claims priority to and benefit of U.S. Ser. No. 60/741,352, TASTE RECEPTOR GENES AND PROTEINS by Zuker and Huang, Filed Nov. 30, 2005. This application is a CIP of and claims priority to U.S. Ser. No. 11/483,423 MAMMALIAN SOUR/ACID TASTE AND CSF RECEPTOR GENES, POLYPEPTIDES AND ASSAYS by Zuker and Huang filed Jul. 6, 2006. Each of these prior applications are incorporated herein by reference in their entirety.

FIELD OF THE INVENTION

[0003]The invention includes the surprising discovery that PKD1-L3, previously implicated as a potential polycystic kidney disease gene, encodes a taste receptor protein (denoted polycystin 1-like 3, or "PC-1-L3"). PC-1-L3 is a transmembrane ion channel protein that is co-expressed with taste receptor protein polycystin 2-like 1, ("PC-2-L1"), encoded by PKD2-L1, in taste receptor cells.

BACKGROUND OF THE INVENTION

[0004]Taste transduction is one of the most sophisticated forms of chemotransduction in animals (Avenet and Lindemann, 1989; Margolskee, 1993; Lindemann, Physiol. Rev. 76:718-766, 1996; Kinnamon et al., Annu. Rev. Physiol. 54:715-731, 1992; and Gilbertson et al., Curr. Opin. Neurobiol. 10: 519-527, 2000). Gustatory signaling is found throughout the animal kingdom, from simple metazoans to the most complex of vertebrates; its main purpose is to provide a reliable signaling response to non-volatile ligands.

[0005]Mammals are believed to have five basic types of taste modalities: salty, sour, sweet, umami (the taste of MSG), and bitter. Each of these is thought to be mediated by distinct signaling pathways leading to receptor cell depolarization, generation of a receptor or action potential and release of neurotransmitter and synaptic activity (Roper (1989) Ann. Rev. Neurosci. 12:329-353).

[0006]In general, the identification of new taste receptors is highly desirable. The identification of a taste receptor provides methods and systems for screening for new tastants, such as the identification of new artificial tastants (sweeteners, sour flavors, salt substitutes, etc.) and for the identification of activity modulators that produce a greater receptor response to specified amounts of a tastant. For example, the use of sour or other flavor enhancers may be useful in reducing the amount of sour or other flavoring needed to provoke, enhance, reduce or eliminate a sour receptor taste cell response, which may thus be useful as a flavor modulator. Similarly, acid is used as a preservative; the ability to reduce the flavor impact of such preservatives can be useful in food storage and packaging applications.

[0007]Relatively recently, the receptors for bitter, sweet and umami were cloned and shown to be encoded by two families of G-protein coupled receptors (Nelson et al., 2000; Nelson et al., 2001; Zhang et al., 2003; Zhao et al., 2003; Mueller et al., 2005). In contrast, most of the molecular components of the sour pathways are previously unknown. Electrophysiological studies suggested that sour tastants modulate taste cell function by direct entry of H.sup.+ and Na.sup.+ ions through specialized membrane channels on the apical surface of the cell. Thus, ion channels selectively expressed in taste receptor cells could be candidates for mediators of sour/acid tastes. Alternatively, ion channels can function as a final critical signaling component in the activation of taste cells (akin to the role of TRPM5 in sweet, umami and bitter cells; Zhang et al., 2003).

[0008]Many other families of cell receptors are also known to function in a variety of signal transduction events associated with cell sensation. For example, the polycystins (e.g., polycystin-1, or "PC-1" and polycystin-2, or "PC-2," encoded by PKD1 and PKD2, respectively) are integral membrane proteins with large extracellular N termini that are thought to possess a number of functions, including mechanosensation in renal and nodal cilia (reviewed in Nauli and Zhou 2004 "Polycystins and Mechanosensation in renal and nodal cilia" Bioessays 26.8 844-856 Wiley Periodicals). The polycystins fall into two basic classes of proteins, the PC-1-like proteins, which are receptor-like molecules and the PC-2-like proteins, which are ion channels (these proteins can also collectively form ion channel pore complexes). Several studies have found overlapping and interdependent roles for these proteins in various systems, particularly in kidney cells. Mutations in various of these genes cause polycystic kidney disease.

[0009]The present invention includes the surprising discovery that certain of the polycystin genes encode taste receptor proteins.

SUMMARY OF THE INVENTION

[0010]The invention includes the surprising discovery that PKD1-L3, encoding polycystin 1-L3 (PC-1-L3), is a sour/acid taste receptor protein. Applicants previously described the surprising discovery that PKD2-L1, which encodes polycystin 2-L1 (PC-2-L1), is a sour/acid taste receptor protein. See, co-pending application U.S. Ser. No. 11/176,958 and U.S. Ser. No. 11/483,423, incorporated herein by reference for all purposes. PC-1-L3 has been found to be a likely partner for polycystin-2L1 in some, though not all tissues expressing PKD2L1, including certain taste receptor cells. PKD1-L3 and PKD2-L1 are co-expressed in taste receptor cells in vivo and their products interact in sour/acid taste signaling in those cells. The surprising discovery that PC-1-L3 and PC-2-L1 are specifically co-expressed in certain taste receptor cells, suggesting that they form taste receptor protein complexes (e.g., including PC-1-L3 and/or PC-2-L1) in those cells (e.g., in the form of receptors and/or ion channels and/or receptor/channel complexes) provides receptor targets for tastant and activity modulator identification and for studies on any taste-related physiological or behavioral effects mediated by either of these polypeptides, separately, and/or in combination.

[0011]Previously, PC-1-L3 and PC-2-L1 were though to be primarily involved in kidney function, as defects in various closely related PKD1 and PKD2 genes (encoding PC-1 and PC-2 proteins) are known to cause polycystic kidney disease. The surprising discovery that PC-1-L3 and PC-2-L1 are specifically co-expressed in taste receptor cells, suggesting that they form taste receptor protein complexes (e.g., including PC-1-L3 and/or PC-2-L1) in those cells (e.g., in the form of receptors and/or ion channels and/or receptor/channel complexes) provides receptor targets for tastant and activity modulator identification and for studies on any taste-related behavioral effects mediated by these proteins, separately, and/or in combination. The PC-2-L1 receptor protein has been definitively assigned as the sour/acid receptor (see, e.g., U.S. Ser. No. 11/483,423), as well as having a role in CNS acid receptor sensation. Based on the association between PC-2-L1 and PC-1-L3 in certain taste receptors, PC-1-L3 is assigned as a component of the sour/acid sensation pathway.

[0012]Assays of the invention can be cell or tissue based, e.g., screening of natural or transgenic cells, or transfected cells or tissues expressing PKD1-L3, PKD2L1, PC-2-L1 and/or PC-1-L3 for activity in response to test compounds, or can be behaviorally based on whole animal studies. For animal studies, transgenic non-human animals (e.g., mice) can be produced, including PKD1-L3 and/or PKD2-L1 knock-outs and transgenic animals comprising heterologous PKD1-L3 and/or PKD2-L1 genes, e.g., to facilitate behavioral and tastant studies for PKD1-L3 and/or PKD2-L1 gene(s) and encoded proteins of interest. For example, a PKD1-L3 and/or PKD2-L1 knock-out mouse can be made transgenic with the PKD2-L1 and/or PKD1-L3 gene from a human, and the resulting transgenic mouse used to study responses to putative human PC-2-L1 and/or PC-1-L3 binders and activity modulators. In addition, the invention provides for the identification of taste-receptor defects at the molecular level (e.g., thorough detection of PKD1-L3 and/or PKD2-L1 polymorphisms) and for the correction of these defects by gene therapy. Corresponding systems and kits are also included. Further details regarding these and other features of the invention are found herein.

[0013]Thus, in a first aspect, the invention provides methods of identifying a compound that binds to and/or modulates an activity of a PC-1-L3 receptor polypeptide, or a PC-2-L1/PC-1-L3 polypeptide complex. Typically, the method includes contacting a biological or biochemical sample comprising the polypeptide or complex with a test compound. Binding of the test compound to the PC-1-L3 receptor polypeptide or PC-2-L1/PC-1-L3 polypeptide complex, and/or modulation of the activity of the polypeptide or polypeptide complex by the test compound is detected. This identifies the compound that binds to and/or modulates the activity of the PC-1-L3 receptor polypeptide and/or complex.

[0014]In a closely related aspect, the invention provides methods of screening for a compound that binds to and/or modulates an activity of a PC-1-L3 taste receptor polypeptide, or a PC-2-L1/PC-1-L3 polypeptide complex. The method includes contacting a biological or biochemical sample comprising the PC-1-L3 taste receptor polypeptide or PC-2-L1/PC-1-L3 polypeptide complex with a test compound, and determining whether the test compound binds to the PC-1-L3 taste receptor polypeptide or PC-2-L1/PC-1-L3 polypeptide complex, and/or modulates an activity of the polypeptide or polypeptide complex by the test compound, thereby screening the compound for binding to and/or modulation of the PC-1-L3 taste receptor polypeptide or PC-2-L1/PC-1-L3 polypeptide complex.

[0015]Related methods of modulating an activity of a cell expressing a polycystin-1L3 or polycystin 2L1-polycystin 1L3 polypeptide or complex, are also a feature of the invention. These methods include contacting the cell with a compound that binds to or modulates an activity of the polypeptide or complex, e.g., as identified herein. In addition to modulating activity, such compounds can be used for labeling the cell to detect PC-2-L1, PC-1-L3, complexes thereof, PKD1L3 and/or PKD2L1, e.g., using in situ hybridization experiments. Examples of modulators/labels include antibodies against the polypeptide or complex and nucleic acids that hybridize to PKD1L3 or PKD2L1 (including probes, anti-sense RNAs, SiRNAs, RNAs, tncRNAs, smRNAs, and/or other probes or DNA or RNA interference moieties).

[0016]For these methods, the biological sample can be moved into contact with the test compound, or vice versa, depending on the format of the method that is selected. For example, either the test compound or the polypeptide can be fixed in position, e.g., in a solid phase or liquid phase array, and the appropriate polypeptide or test compound can be contacted to the fixed component. Alternately, both polypeptide and test compound can be in a mobile phase, e.g., in a microfluidic device. Thus, "contacting" in these methods refers to the polypeptide and test compound being brought into contact with each other, regardless of which component is moved to achieve contact of the relevant components.

[0017]Typically, where the assay methods of the invention are cell-based, such assays can be used in a high throughput fashion to screen one or use preparations of cellular materials. In these embodiments, the biological sample comprises or is derived from a cell that expresses the polycystin-2L1 and/or polycystin-1L3 taste receptor polypeptide(s). Most typically, such cells are provided by expressing an appropriate gene in a recombinant cell. The gene is typically, though not necessarily, heterologous to the recombinant cell. Binding of the test compounds to the receptor polypeptide(s)/complex, or modulation of the activity of the polypeptide(s)/complex by the test compounds is detected, e.g., in a high throughput screen, thereby identifying compounds that bind to or modulate the activity of polypeptide(s). The polypeptide(s) can include taste receptor polypeptides, pH sensing receptor polypeptides (including in the CSF, where PC-2-L1 is an acid sensor), and/or the like.

[0018]Regardless of assay format, one or more biological sample comprising one or more PC-1-L3 receptor polypeptide or PC-2-L1/PC-1-L3 polypeptide complex can be contacted with a plurality of test compounds. Binding of the test compounds to the PC-1-L3 receptor polypeptide or PC-2-L1/PC-1-L3 polypeptide complex, or modulation of the activity of the polypeptide by the test compounds can then be detected, thereby identifying one or more compound that binds to or modulates the activity of the PC-1-L3 taste receptor polypeptide or PC-2-L1/PC-1-L3 polypeptide complex. High throughput cell or in vitro formats that achieve testing of 100, 1,000, 10,000 or more test compounds per hour can be used, as can lower throughput formats, such as in vivo assays using heterologous mice. Test compounds can be pre-screened for any desired property, including toxicity, biodistribution, oral availability, or the like.

[0019]The test compounds can be any of a variety of different compounds, including naturally occurring compounds, ions, sour tastants, small organic molecules, peptides, peptide mimetics, an acid, a weak acid, CO, CO.sub.2, acetic acid, a specific blocker of carbonic anhydrase, MK-417, an ion channel agonist, an ion channel antagonist, an ion channel enhancer, a non-specific Ca.sup.+ channel blocker, Nifedipine and structurally related compounds, Verapamil and structurally related compounds, gadolinium and structurally related compounds, a stretch-induced channel blocker, an antibody to the polypeptide or complex, or the like. In one preferred embodiment, the test compound enhances an activity of the PC-1-L3 taste receptor polypeptide or PC-2-L1/PC-1-L3 polypeptide complex, e.g., by potentiating an activity of the PC-1-L3 taste receptor polypeptide or PC-2-L1/PC-1-L3 polypeptide complex. In another preferred aspect, the test compound inhibits or blocks an activity of the PC-1-L3 taste receptor polypeptide or PC-2-L1/PC-1-L3 polypeptide complex.

[0020]The biological sample from which the PC-1-L3 and/or PC-2-L1 polypeptides are derived can include or be derived from a cell that expresses the PC-1-L3 taste receptor polypeptide or the PC-2-L1/PC-1-L3 complex. The precise source of PC-1-L3 used in the methods and compositions herein will vary depending on the application. For example, a human polypeptide can be used in in vitro or in vivo tastant and/or modulator studies to determine the likely effects of test compounds in human populations. Thus, the PC-1-L3 taste receptor polypeptide is optionally any polypeptide homologous to, e.g., the human or murine PC-1-L3, including the human and/or murine PC-1-L3 taste receptor polypeptide(s). Similarly, the PC-2-L1 in a PC-2-L1/PC-1-L3 complex can be any such polypeptide, resulting, e.g., in a human or murine PC-2-L1/PC-1-L3 polypeptide complex (or a complex with heterologous components, such as a human/murine peptide complex). Polypeptides derived from humans, laboratory animals and/or domesticated or livestock animals are useful in the various methods herein, as are those derived from wild animals. Here again, the selection of the most appropriate polypeptide depends on the intended end-application for information of tastant or modulation activity of a test compound of interest. For example, where modulators of the receptor in humans are sought, human proteins can be used, e.g., in a cell-based system where the genes for the proteins are recombinantly expressed in the cell, or, e.g., in a transgenic model system suitable for tastant or modulator analysis, such as a knock-out mouse that expresses the human proteins. Similarly, in veterinary applications, recombinant or transgenic models can be used to assess tastants or modulators, e.g., for livestock applications.

[0021]In one aspect, the biological source of PC-1-L3 or PC-2-L1 can be a PKD1-L3 or a PKD2L1 gene expressed in a recombinant cell, or the PKD1-L3 gene and PKD2L1 genes can both be expressed in a recombinant cell. Generally, the PKD-L3 gene, the PKD2-L1 gene or both the PKD1-L3 and the PKD2L1 gene is or are heterologous to the recombinant cell (e.g., a human, rodent or insect cell), which can be in culture, in vivo, derived from a cultured or in vivo cell (e.g., a primary cell, such as a cell derived from a taste bud or kidney cell) or the like.

[0022]A variety of different tastant/modulator/moieties can be detected for binding or activity on PC-1-L3 and/or PC-1-L3/PC-2-L1 complexes. For example, the methods can include detecting binding between the PC-1-L3 taste receptor polypeptide and a moiety such as a PC-2-L1 polypeptide, a potentiator of the PC-1-L3 taste receptor polypeptide, an antagonist of the PC-1-L3 taste receptor polypeptide, an agonist of the PC-1-L3 taste receptor polypeptide, an inverse agonist of the PC-1-L3 taste receptor polypeptide, a ligand that specifically binds to the PC-1-L3 taste receptor polypeptide, and/or an antibody that specifically binds to the PC-1-L3 taste receptor polypeptide. Similarly, the methods optionally include detecting binding between the PC-2-L1/PC-1-L3 polypeptide complex and a moiety such as: a potentiator of the complex, an antagonist of the complex, an agonist of the complex, an inverse agonist of the complex, a ligand that specifically binds to the complex, and an antibody that specifically binds to the complex.

[0023]Binding or activity can be detected, e.g., in vitro, in situ or in vivo, and optionally includes detection of the PC-1-L3 taste receptor polypeptide or the PC-2-L1/PC-1-L3 polypeptide complex. Alternately (or additionally) a signal resulting from an activity of the PC-1-L3 taste receptor polypeptide or the PC-2-L1/PC-1-L3 polypeptide complex can be detected. The signal can be, e.g., a conformation-dependent signal, e.g., where a conformation of the PC-1-L3 taste receptor polypeptide or the PC-2-L1/PC-1-L3 polypeptide complex is modified by binding of the test compound to the PC-1-L3 taste receptor polypeptide or to the PC-2-L1/PC-1-L3 polypeptide complex.

[0024]Detecting binding of a test compound to the PC-1-L3 taste receptor polypeptide or the PC-2-L1/PC-1-L3 polypeptide complex, or activity of the test compound on the PC-1-L3 taste receptor polypeptide or the PC-2-L1/PC-1-L3 polypeptide complex can be performed in a variety of different formats. These include detecting binding between PC-2-L1 and PC-1-L3, formation or stability of the polypeptide complex, H.sup.+ flux, Na.sup.+ flux, Ca.sup.2+ flux, ion flux, changes in an activity of an intracellular pH or ion sensor, depolarization of the cell, cell membrane voltage changes, cell membrane conductivity changes, a kinase activity triggered upon binding of a compound to the PC-1-L3 taste receptor polypeptide, generation, breakdown or binding of a phorbol ester by the PC-1-L3 taste receptor polypeptide, binding of diacylglycerol or other lipids by the PC-1-L3 taste receptor polypeptide, cAMP activity, cGMP activity, GTPgammaS binding, phospholipase C activity, activity of an enzyme involved in cellular ionic balance, binding of PC-1-L3 to another PKD protein, and/or a transcriptional reporter activity.

[0025]In one aspect, the PC-1-L3 taste receptor polypeptide, the PC-2-L1 polypeptide, or the PC-2-L1/PC-1-L3 complex is incorporated into a biosensor. Such a biosensor can incorporate standard sensing features such as the use of a Chem-FET, readout, display, etc.

[0026]Systems for practicing these and other methods are also a feature of the invention. For example, a system of the invention for detecting compounds that bind to or modulate an activity of a PC-1-L3 taste receptor polypeptide or PC-2-L1/PC-1-L3 complex is provided. The system includes, e.g., a biological sample comprising the PC-1-L3 taste receptor polypeptide or the PC-2-L1/PC-1-L3 polypeptide complex, a source of a plurality of test compounds, and a detector capable of detecting binding of one or more of the test compounds to the PC-1-L3 taste receptor polypeptide or PC-2-L1/PC-1-L3 polypeptide complex, or modulation of the activity of the polypeptide or complex by one or more of the test compounds. This provides for the identification of a putative tastant compound that binds to or modulates the activity of the polypeptide or complex.

[0027]The source of biological samples, genes, test compounds, etc., can be any of those noted above with respect to methods of the invention. In one aspect, the test compounds include a library of tastant compounds. This library can be of, e.g., compounds of interest, and can, optionally, be pre-screened or pre-selected for any desirable property (structure, binding to a PC protein, bioavailability, toxicity, etc.).

[0028]The detector can employ any available detection system, e.g., can be a patch clamp device, an optical detection device, or the like. For example, the detector can include a fluorescence detector that detects FRET, changes in membrane potential or flow of a dye into or out of the cell.

[0029]In addition to, or in an embodiment of the methods and systems above, methods and systems for monitoring tastant-induced behavior in vivo, e.g., using an appropriate model system.

[0030]For example, the invention includes a method of detecting a taste-induced behavior modulated by a PC-1-L3 taste receptor polypeptide or PC-2-L1/PC-1-L3 taste receptor polypeptide complex. For example, the methods can include (a) introducing a heterologous PKD1-L3 taste receptor gene into an animal such as a mouse and expressing an encoded heterologous PC-1-L3 taste receptor polypeptide in a taste bud of the animal; (b) providing a putative taste receptor tastant or modulator to the animal; and, (c) monitoring a feeding behavior of the animal in response to the presence of the putative taste receptor tastant.

[0031]A heterologous PKD2-L1 can be gene into the animal and an encoded polycystin 2-L1 polypeptide in the taste bud, e.g., the resulting PC-2-L1/PC-1-L3 taste receptor polypeptide complex that forms in the taste bud is heterologous to the animal. For example, the animal can be a mouse and the heterologous PKD1L3 and/or PKD2L1 gene can be a human PKD1L3 taste receptor gene. The gene can include a heterologous promoter that is active in the taste bud of the animal, such as a PKD2-L1 promoter, a PKD1-L3 promoter, a T1R-- gene promoter, T2R-- gene promoter, TRPM5-gene promoter, a PLCB2 gene promoter, a repeater gene promoter, a gustducin gene promoter, a Gi2 gene promoter, a cytokeratin-19 gene promoter, or a promoter for a gene that is naturally selectively expressed in a taste receptor cell of the tongue or palate epithelium.

[0032]The precise format of the assay can vary, depending on available instrumentation. In one typical embodiment, a putative tastant or modulator is provided on a licking device to the animal and licking behavior of the animal on the device is monitored, optionally in conjunction with the overall feeding behavior of the animal (e.g., increases or decreases in feeding behaviors, e.g., feeding on sour or acidic foods, or the like).

[0033]Observations can be adjusted for various controls, or compared to behavior changes induced by known tastants or modulators. For example, the putative tastant or modulator can be provided to the animal in conjunction with a control compound and the relative frequency of feeding behavior caused by the putative tastant can be compared to the control compound.

[0034]Any of the various tastants or modulators noted above or herein can be applied to these methods as well, e.g., the taste receptor tastant or modulator can include an agonist, enhancer, antagonist, or inverse agonist of a PC-1-L3 polypeptide or the PC-2-L1/PC-1-L3 taste receptor polypeptide complex.

[0035]Related systems for detecting a taste-induced behavior or physiological effect modulated by a PC-1-L3 taste receptor polypeptide or PC-2-L1/PC-1-L3 taste receptor polypeptide complex are similarly provided. In one example, the system includes: (a.) a non-human animal comprising a heterologous PKD1-L3 taste receptor gene that is expressed in a taste bud of the animal; (b.) a source of a putative tastant that is accessible to the animal; and (c.) a detector that detects a feeding behavior of the animal in response to the presence of the putative tastant.

[0036]Here again, the animal can be a knock-out mouse deficient in endogenous PC-1-L3 taste receptor polypeptide expression, e.g., a mouse that expresses a heterologous human PC-1-L3 taste receptor polypeptide. Optionally, the animal can be a double knockout deficient in endogenous PC-1-L3 taste receptor polypeptide expression and endogenous polycystin 2-L1 expression, e.g., a mouse expressing a heterologous human PC-1-L3 taste receptor polypeptide and a heterologous human polycystin 2-L1 polypeptide.

[0037]The source can include, e.g., a lickable device, a fluid source comprising the tastant, or a food source comprising the tastant. The detector can include, e.g., a camera that detects movement by the animal. Optionally, the system further includes an analysis module operably linked to the detector, e.g., an analysis module (e.g., software in a computer) that analyzes information received from the detector.

[0038]In another embodiment, the invention provides a recombinant cell that includes a heterologous PKD1-L3 gene and a heterologous PKD2-L1 gene. As in other aspects herein, the cell can be, e.g., a human, rodent or insect cell. Any of the various permutations of PKD genes noted herein optionally apply to this embodiment as well, e.g., wherein the PKD1-L3 taste receptor gene or the heterologous PKD2-L1 gene are human, murine, or the like. Typically, the PKD1-L3 gene and the heterologous PKD2-L1 are expressed in the cell and a polycystin 2-L1 polypeptide/PKD3-L1 polypeptide complex is formed in the cell, or in or on a membrane of the cell.

[0039]Similarly, in a related aspect, the invention provides an isolated or recombinant polypeptide complex that includes at least one of: a recombinant PC-1-L3 polypeptide and/or a recombinant polycystin 2-L1 polypeptide. Typically, the complex further includes at least one of: a PC-1-L3 polypeptide, a polycystin 2-L1 polypeptide, a recombinant PC-1-L3 polypeptide and/or a recombinant polycystin 2-L1 polypeptide. For example, in one embodiment, an isolated or recombinant polypeptide complex of the invention includes recombinant human PC-1-L3 polypeptide and a recombinant human polycystin 2-L1 polypeptide. The isolated or recombinant polypeptide can be (and typically is) expressed in one or more recombinant cell(s).

[0040]Recombinant taste bud cells are also a feature of the invention. For example, a taste bud cell that includes a heterologous PKD1-L3 taste receptor gene, or a heterologous PC-1-L3 taste receptor polypeptide is a feature of the invention. Optionally, the recombinant taste bud cell further includes a heterologous PKD2-L1 gene. The taste bud cell can be, e.g., present in a recombinant (e.g., transgenic) non-human animal.

[0041]A knock out non-human animal comprising a defect in a native PKD1-L3 taste receptor gene or a defect in native PKD1-L3 gene expression is also a feature of the invention. For example, a double knock-out animal, such as a mouse, deficient in endogenous PC-1-L3 taste receptor polypeptide expression and endogenous polycystin 2-L1 expression is provided. This knock-out animal can include a heterologous PKD1-L3 taste receptor gene (and, optionally, a recombinant PKD2-L1 gene) that is expressed in the tastebud of the animal. For example, a PKD1-L3 and/or PKD2-L1 knock out mouse expressing a heterologous human PKD1-L3 gene and/or a PKD2-L1 gene is a feature of the invention.

[0042]Methods of detecting a molecular basis for a taste receptor function abnormality are also provided. The methods include determining whether a biological sample from a patient comprises a polymorphism in a gene encoding PKD1-L3 or an abnormality in expression of PKD1-L3. The polymorphism is correlated with an abnormality in taste receptor function, thereby determining whether the patient has a genetic basis for a taste receptor function abnormality. For example, the polymorphism can be a single nucleotide polymorphism, a rearrangement, a splicing variant, an expression variant, or the like. For example, the abnormality can be a variation in the expression of PKD1-L3 such as an abnormal tissue distribution of PKD1-L3 mRNA or PC-1-L3 polypeptide in the organism at issue.

[0043]Methods of rescuing a taste receptor cell that has altered or missing PKD1-L3 taste receptor function, are provided. In these methods, a nucleic acid encoding a recombinant polypeptide homologous to PC-1-L3 (e.g., a naturally occurring PC-1-L3 gene) is introduced into the cell and expressed. This provides PKD1-L3 function to the cell. Any of the various features noted herein can be applied to this embodiment as well, e.g., the cell can be in cell culture, in a tissue, in a taste bud, in a mammal, etc.

[0044]Kits for practicing the above methods are also a feature of the invention. The kits can include, e.g., a PKD1L3 and/or PKD2L1 nucleic acid, e.g., one or more vectors comprising a PKD1L3 and/or PKD2L1 gene, a PC-1-L3 and/or PC-2-L1 polypeptide, recombinant cells expressing these gene or polypeptides, transgenic animals, etc., as noted above. The kits can further include instructions for using the other kit components to practice the methods herein, system components, packaging materials for packaging the components noted above, etc.

BRIEF DESCRIPTION OF THE FIGURES

[0045]FIG. 1 shows results from the RNA in situ hybridization in circumvallate taste papillae.

[0046]FIG. 2A-2B provide an alignments of sequences for human, rat, and mouse PKD2L1.

[0047]FIG. 3 is photograph showing results demonstrating that PKD1L3 selectively labels taste receptor cells.

[0048]FIG. 4 is an alignment of PKD1L3 sequences.

[0049]FIG. 5, Panels A show a series of traces showing the taste impact of eliminating cells expressing PKD2L1 in the tongue. Note the total loss of sour taste in nerve responses. As a control also included are wild type mice (upper traces) and engineered animals where sweet cells have been ablated (middle traces). Panel B shows histograms of response for wild-type and ablated animals.

[0050]FIG. 6, panels A-G shows PKD2L1 expression in cells surrounding the central canal.

[0051]FIG. 7A-C shows a diagram of the central canal, a labeled photomicrograph and a series of traces showing pH responses of PKD2L1-expressing cells surrounding the central canal.

[0052]FIG. 8, panels A and B show in situ hybridization images.

[0053]FIG. 9 shows antibody in situ hybridization results for binding of antibodies to PKD1L3 and PKD2L1.

[0054]FIG. 10 illustrates loss of selective TRCs in DTA-expressing animals. Panel A Upper diagram illustrates the strategy used to target DTA or GFP to selective populations of TRCs. Panel B lower panels show in situ hybridization experiments examining the presence of sweet (T1Rs), bitter (T2Rs) or PKD2L1-expressing cells in the two engineered lines.

DEFINITIONS

[0055]Before describing the present invention in detail, it is to be understood that this invention is not limited to particular technical systems, or biological components, which can, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting. As used in this specification and the appended claims, the singular forms "a", "an" and "the" include plural referents unless the content clearly dictates otherwise.

[0056]Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the invention pertains. Although any methods and materials similar or equivalent to those described herein can be used in the practice for testing of the present invention, the preferred materials and methods are described herein. In describing and claiming the present invention, the following terminology will be used in accordance with the definitions set out below.

[0057]A "polycystin-1L3 polypeptide" or "polycystin-1L3 receptor polypeptide" is a polypeptide that is the same as, a splice-variant of, or homologous to a human polycystin-1L3 or murine polycystin-1L3, or that is derived from such a polypeptide (e.g., through cloning, recombination, mutation, or the like). The polypeptide can be full length or can be a fragment of a full length protein. A polycystin-1L3 fragment typically includes at least 10 contiguous amino acids corresponding to a native polycystin-1L3 protein, such as a human murine, dog or rat polycystin-1L3. The polycystin-1L3 receptor polypeptide can be naturally occurring or recombinant, and can be unpurified, purified, or isolated, and can exist, e.g., in vitro, in vivo, or in situ. In one typical useful embodiment, the polycystin-1L3 receptor polypeptide is a transmembrane protein. As described herein, in useful embodiments, the polycystin-1L3 receptor polypeptide can be a component of a sour/acid receptor, in any of a variety of contexts, including as a taste receptor polypeptide, as a CSF receptor polypeptide or as an acid receptor in other systems, e.g., in the kidney.

[0058]A "polycystin-1L3 taste receptor polypeptide" is a polypeptide that is the same as, a splice-variant of, or homologous to a human polycystin-1L3 or murine polycystin-1L3 and that is expressed in taste receptor cells, or that is derived from such a polypeptide that is expressed in such taste receptor cells (e.g., through cloning, recombination, mutation, or the like). The polypeptide can be full length or can be a fragment of a full length protein. A polycystin-1L3 fragment typically includes at least 10 contiguous amino acids corresponding to a native polycystin-1L3 protein, such as a human murine, dog or rat polycystin-1L3. The polycystin-1L3 taste receptor polypeptide can be naturally occurring or recombinant, and can be unpurified, purified, or isolated, and can exist, e.g., in vitro, in vivo, or in situ. In one typical useful embodiment, the polycystin-2L1 taste receptor polypeptide is a transmembrane protein.

[0059]A "polycystin-2L1 polypeptide" or a polycystin-2L1 receptor polypeptide is a polypeptide that is the same as, a splice-variant of, or homologous to a human polycystin-2L1 or murine polycystin-2L1, or that is derived from such a polypeptide (e.g., through cloning, recombination, mutation, or the like). The polypeptide can be full length or can be a fragment of a full length protein. A polycystin-2L1 fragment typically includes at least 10 contiguous amino acids corresponding to a native polycystin-2L1 protein, such as a human murine, dog or rat polycystin-2L1. The polycystin-2L1 receptor polypeptide can be naturally occurring or recombinant, and can be unpurified, purified, or isolated, and can exist, e.g., in vitro, in vivo, or in situ. In one typical useful embodiment, the polycystin-2L1 receptor polypeptide is a transmembrane protein. As described herein, in useful embodiments, the polycystin-2L1 receptor polypeptide can be a sour/acid receptor, in any of a variety of contexts, including as a taste receptor polypeptide, as a CSF receptor polypeptide or as an acid receptor in other systems, e.g., in the kidney.

[0060]A "polycystin-2L1 taste receptor polypeptide" is a polypeptide that is the same as, a splice-variant of, or homologous to a human polycystin-2L1 or murine polycystin-2L1 and that is expressed in taste receptor cells, or that is derived from such a polypeptide that is expressed in such taste receptor cells (e.g., through cloning, recombination, mutation, or the like). The polypeptide can be full length or can be a fragment of a full length protein. A polycystin-2L1 fragment typically includes at least 10 contiguous amino acids corresponding to a native polycystin-2L1 protein, such as a human murine, dog or rat polycystin-2L1. The polycystin-2L1 taste receptor polypeptide can be naturally occurring or recombinant, and can be unpurified, purified, or isolated, and can exist, e.g., in vitro, in vivo, or in situ. In one typical useful embodiment, the polycystin-2L1 taste receptor polypeptide is a transmembrane protein.

[0061]A "PKD1L3 gene" is a nucleic acid that encodes a PC-1-L3 polypeptide. Typically, the gene includes regulatory sequences that direct expression of the gene in one or more cells of interest. Optionally, the PKD1L3 gene is a native gene that includes regulatory and coding sequences that naturally direct expression of a PC-1-L3 polypeptide.

[0062]A "PKD2L1 gene" is a nucleic acid that encodes a PC-2-L1 polypeptide. Typically, the gene includes regulatory sequences that direct expression of the gene in one or more cells of interest. Optionally, the PKD2L1 gene is a native gene that includes regulatory and coding sequences that naturally direct expression of a PC-2-L1 polypeptide.

[0063]A biological sample comprising the PC-2-L1 and/or PC-1-L3 polypeptide includes any sample comprising the PC-2-L1 and/or PC-1-L3 polypeptide that is derived from a biological source, e.g., cells, tissues, organisms, cells, secretions, etc. These samples can include, e.g., cells expressing the receptor, membranes containing the receptor, receptor bound to a chemical matrix, receptor bound to solid surface (e.g., for plasmon resonance), etc. A biochemical source can include biological sources and/or non-biological sources, such as purely synthetic preparations of materials.

[0064]A "tastant" is a compound that can be tasted by the relevant organism. These typically include compounds that can stimulate or inhibit one or more activity of one or more taste receptor, taste cells or other sensory cells and/or nerves in the oral cavity. A tastant can be any molecule, including ions, peptides, nucleotides, natural compounds, small organic molecules, etc. that leads to modulation of taste receptor or taste cell activity or a change taste cell function either on its own or in the presence of other compounds.

[0065]A "modulator" is a compound that modulates an activity of a given polypeptide, polypeptide complex or receptor, e.g., a taste receptor polypeptide complex, e.g., in response to a tastant, or polypeptide or polypeptide complex in response to a change in pH. The term "modulate" with respect to a polycystin-2L1 polycystin-1L3 polypeptide refers to a change in an activity or property of the polypeptide. For example, modulation can cause an increase or a decrease in a protein activity, a binding characteristic, membrane permeability or any other biological, functional, or immunological properties of such proteins. The change in activity can arise from, for example, an increase or decrease in expression of one or more genes that encode these proteins, the stability of an mRNA that encodes the protein, translation efficiency, or from a change in activity of the protein itself. For example, a molecule that binds to polycystin-2L1 or polycystin-1L3 can cause an increase or decrease in a biological activity of the polypeptide. Example modulators include polycystin-2L1 or polycystin-1L3 allosteric enhancers, agonists, antagonists, inverse agonists, or partial agonists, polycystin-2L1 or polycystin-1L3 ligands, antibodies to polycystin-2L1, polycystin-1L3, or complexes thereof, etc.

[0066]A taste receptor "modulator" is a compound that modulates an activity of a taste receptor, e.g., in response to a tastant. The term "modulate" with respect to a PC-2-L1 and/or PC-1-L3 polypeptide refers to a change in an activity or property of the polypeptide or polypeptide complex. For example, modulation can cause an increase or a decrease in a protein activity, a binding characteristic, membrane permeability or any other biological, functional, or immunological properties of such proteins. The change in activity can arise from, for example, an increase or decrease in expression of one or more genes that encode these proteins, the stability of an mRNA that encodes the protein, translation efficiency, or from a change in activity of the protein itself. For example, a molecule that binds to PC-1-L3 and/or PC-2-L1 can cause an increase or decrease in a biological activity of the polypeptide or complex. Example modulators include PC-1-L3 and/or PC-2-L1 allosteric enhancers, agonists, antagonists, inverse agonists, or partial agonists, PC-1L3 and/or PC-2-L1 ligands, antibodies to PC-1-L3, PC-2-L1, or a complex of PC-1-L3 and PC-2-L1, etc.

[0067]A "prescreened" compound is a compound that is pre-selected for a property of interest, such as toxicity, lack of toxicity, bioavaliability, chemical structure, type of molecule (natural product, ion, ion channel agonist/antagonist/inverse agonist, etc.), or the like. For example, an "ingestible compound" is a compound that can be safely ingested in an amount that triggers a taste receptor or taste cell response by the compound. Certain compounds such as agonists or enhancers can have such a desired response when present at very low doses, while others are present in higher amounts. In addition, certain ingestible compounds such as enhancers optionally have no taste of their own, but enhance the action of natural or chemically synthesized tastants on a taste receptor or taste cell.

[0068]A "transmembrane potential" is the work needed to move a unit of charge across a membrane such as a cell membrane.

[0069]A "cationic membrane permeable dye" is a dye which has a positive charge under specified pH (e.g., physiological pH) where the dye can cross a selected membrane such as the membrane of an intact cell.

[0070]An "anionic membrane permeable dye" is a dye which has a negative charge at a specified pH (e.g., physiological pH) and which is membrane permeable and whose distribution between the inside and outside of the space bounded by the membrane or between the inside and outside of the membrane, depends on the transmembrane potential across the membrane.

[0071]A "neutral dye" has an overall neutral charge under the relevant conditions at issue, e.g., a specified pH (e.g., physiological pH).

[0072]A "voltage sensing composition" is a transmembrane potential indicator, e.g., comprising a fluorescent dye. Common voltage sensing compositions of the invention include one or more cationic or anionic membrane permeable dye(s).

[0073]A membrane is "depolarized" when the transmembrane potential across the membrane becomes more positive inside. A membrane is "hyperpolarized" when the transmembrane potential becomes more negative inside.

[0074]A membrane is "permeable" to a given component (dye, ion, etc.) when that component can cross the membrane. Permeability can be dependent upon the relevant conditions, e.g., temperature, ionic conditions, voltage potentials, or the like.

DETAILED DESCRIPTION

[0075]The ability to screen taste (and other) receptors for response to modulators, tastants and taste receptor modulators is of considerable commercial value. Libraries of putative tastant and/or modulator compounds can be screened for activity against a given receptor to identify taste modulators, taste enhancers, sour tastants, and the like. For example, the identification of new sour/acid or other tastants is of value, e.g., to provide new flavors that can be added to foods and drinks. Similarly, compounds that modulate activity of a receptor can be used to make the receptor more (or less) sensitive to a tastant, which is particularly valuable when considering responsiveness to sour/acid or other tastants that have associated health consequences upon consumption. For example, many preservatives utilize acids, which impact flavors. The ability to neutralize flavor effects facilitates the use of food preservatives. In one aspect of the invention, PC-1-L3, PC-2-L1 or PC1-L3/PC2-L1 complexes are tested for responsiveness to sour or acidic compounds, and modulators of the receptor are identified. Modulators of the genes for these proteins can similarly be tested for effects on the expression of the proteins.

[0076]Given the identification of polycystin-2L1 as a sour/acid taste receptor protein, and of polycystin-1L3 as a potential partner for polycystin-2L1, there are several ways in which these proteins can now be screened for responsiveness to test compounds (tastants, activity modulators, etc.). These include high-throughput cell-based assays, animal behavioral models (e.g., using transgenic animals that express a human or other desirable heterologous PC-1-L3, PC-2-L1 or PC1-L3/PC2-L1 polypeptides), or the like. Modulators of the genes for these polypeptides can similarly be tested for effects on the expression of the proteins. Polymorphisms in the gene for PC-1-L3 (PKD1L3) and PC-2-L1 (PKD2L1) can also be detected to provide a molecular test for tasting disorders and defects in PKD1L3 and/or PKD2L1, which can also be rescued by gene therapy. In this regard, administration of a gene therapy vector to the tastebud is relatively simple, due to ready access to this tissue, and can be targeted to a considerable degree simply by controlling the site of vector administration. Systems and kits for practicing the methods, transgenic animals (PKD1L3/PKD2L1 knock-outs and/or transgenics), and related features are also included within the scope of the invention. Further details regarding these various features of the invention are found herein.

[0077]In addition to the identification of PC-2L1 as a sour/acid taste receptor, PC-2L1 has also been identified as a pH (e.g., acid level) sensor in certain neuronal cells that are in contact with the CSF (e.g., part of the system that monitors blood CO.sub.2). While PC-1-L3 has, thus far, not been found in association with PC-2L1 in the CSF, it is possible that PC-1-L3 may form part of an acid sensor in cells outside of the taste system, e.g., in the CSF, kidney, or the like. This provides, e.g., a basis for assays that screen for modulators of PC-1L3 and complexes of PC-1-L3 with PC-2-L1 in the context of its role as an acid (pH) sensor outside of any function in sour/acid taste sensation. pH sensation regulates, e.g., respiration. Defects in respiration lead to a variety of disorders, including sudden infant death syndrome (SIDS), sleep apnea, persistent hiccups, fatigue, altitude sickness, hyperventilation, and many others. In addition, patients suffering from trauma, anesthesia, or surgery often develop difficulty breathing, which may benefit from administration of appropriate modulators.

Screening Test Compounds for Activity Against PC-1-L3. PC-2-L1 and/or PC-1-L3/PC-2L1

[0078]In one aspect, methods of identifying a compound that binds to or modulates an activity of a PC-1-L3 or PC-2-L1 polypeptide, or a PC-1-L3/PC-2L1 polypeptide complex are provided. In these methods, a biological or biochemical sample comprising the polypeptide or complex is contacted with a test compound and binding of the test compound to the polypeptide or complex, or modulation of the activity of the polypeptide or complex by the test compound is detected, thereby identifying the compound which binds to or modulates activity.

[0079]Desirably, a test compound can be, e.g., a potentiator or enhancer of the polypeptide and/or complex, an antagonist of the polypeptide and/or complex, an agonist of the polypeptide and/or complex, an inverse agonist of the polypeptide and/or complex, a ligand that specifically binds to the polypeptide and/or complex, an antibody that specifically binds to the polypeptide and/or complex, and/or the like.

[0080]Additional Details Regarding Screening Methods

[0081]High throughput methods of screening are particularly useful in identifying tastants or modulators of activity, and/or of PKD1-L3 and/or PKD2L1 gene expression. Generally in these methods, one or more biological sample that includes one or more PC-1-L3 and/or PC-2-L1 taste receptor polypeptide(s) and/or genes is contacted with a plurality of test compounds. Binding to PC-1-L3, PC-2-L1 or a complex of both PC-1-L3 and PC-2-L1 or modulation of these polypeptides/complexes or genes by the test compounds is detected, thereby identifying one or more compound that binds to or modulates activity of the peptide, complex and/or gene.

[0082]Essentially any available compound library can be screened in such a high-throughput format against a biological or biochemical sample, such as a cell expressing a PC-1-L3 and/or PC-2-L1 polypeptide, and activity of the library members against the polypeptide(s) or expression thereof can be assessed in a high-throughput fashion.

[0083]Many libraries of compounds are commercially available, e.g., from the Sigma Chemical Company (Saint Louis, Mo.), Aldrich chemical company (St. Louis Mo.), and many can be custom synthesized by a wide range of biotech and chemical companies. A variety of proprietary libraries also exist, including those specifically designed for screening of taste receptors, e.g., from Senomyx, Inc. (La Jolla Calif.).

[0084]In one desirable aspect, the plurality of test compounds comprise a plurality of compounds. Thus, the library to be screened can include a previously unscreened library of compounds, or can include a pre-screened library of compounds that are pre-screened for any property that is desired, e.g., toxicity, bioavialability, chemical structure, known activity (e.g., ion channel binding or modulating activity) ingestibility, or the like. Further details on available libraries are found below.

[0085]In general, test compounds that enhance or potentiate an activity of the relevant polypeptide or complex are can be desirable, e.g., to enhance pH sensitivity for certain cells, e.g., to increase respiration, e.g., to reduce altitude effects, or as flavor enhancers, and can be screened for using the methods of the invention. However, test compounds that inhibits or block an activity of the polypeptide or complex are also desirable, e.g., where the taste sensation associated with a flavor would benefit from reduced responsiveness (e.g., in those cases where more than usual of the tastant is desirably consumed), or in cases where decreased pH responsiveness are desirable (e.g., to reduce hyperventilation). For example, reduced sensitivity to acid/sour tastes can be desirable, e.g., to permit greater use of acidic food preservatives.

[0086]Additional Details Regarding Assay Formats

[0087]In another aspect, the present invention relates to the use of PC-1-L3, PC-2-L1, complexes thereof and/or coding nucleic acids in methods for identifying a compound, e.g., a tastant or modulator, that interacts/binds to the polypeptide or complex. The test compound(s) can be any natural or synthetic molecule(s) such as ions, proteins or fragments thereof, carbohydrates, organic or inorganic compounds and/or the like. For example, the test compounds can be naturally occurring compounds, ions, sour tastants, small organic molecules, peptides, peptide mimetics, an acid, a weak acid, CO, CO.sub.2, acetic acid, a specific blocker of carbonic anhydrase, MK-417, an ion channel agonist, an ion channel antagonist, an ion channel enhancer, a non-specific Ca.sup.+ channel blocker, Nifedipine and structurally related compounds, Verapamil and structurally related compounds, gadolinium and structurally related compounds, a stretch-induced channel blocker, etc. This can be achieved, e.g., by utilizing the polypeptides of the invention, including active fragments thereof, in cell-free or cell-based assays. A variety of formats are applicable, including measurement of second messenger effects (e.g., H.sup.+ flux, Na.sup.+ flux, Ca.sup.2+ flux, ion flux, depolarization of the cell, cell membrane voltage changes, cell membrane conductivity changes, a kinase activity triggered upon binding of a compound to the polypeptide or complex, generation, breakdown or binding of a phorbol ester by the polypeptide or complex, binding of diacylglycerol or other lipids by the polypeptide or complex, cAMP activity, cGMP activity, GTPgammaS binding, phospholipase C activity, activity of an enzyme involved in cellular ionic balance, binding of polycystin-2L1or polycystin-1L3 to each other or the relevant polypeptide or complex to another polycystin-type protein, or a transcriptional reporter activity assay, e.g., using CRE, SRE, MRE, TRE, NFAT, and/or NFkB-response elements coupled to appropriate reporters.

[0088]In one embodiment, cell-free assays for identifying such compounds comprise a reaction mixture containing a polycystin polypeptide or complex encoded by PKD2-L1 and/or PKD1-L3 and a test compound or a library of test compounds. Accordingly, one example of a cell-free method for identifying test compounds that specifically bind to PC-1-L3, PC-2-L1, or PC-1-L3/PC-2-L1 complexes comprises contacting a PC-1-L3 protein, PC-2-L1 protein, or PC-1-L3/PC-2-L1 protein complex, or functional fragment thereof, with a test compound or library of test compounds and detecting the formation of test-compound/protein complexes by conventional methods. Similarly, the effect on PC-1-L3/PC-2-L1 complex formation by the test compound can also be determined by monitoring association of the polycystin proteins in the presence and absence of the test compound.

[0089]In one class of useful embodiments, a library of the test compounds can be synthesized on a solid substrate, e.g., a solid surface, plastic pins or some other surface. The test compounds are reacted with the polycystin polypeptide(s) and washed to elute unbound polypeptide(s). Bound polypeptide is then detected by methods well known in the art. A reciprocal assay can also be used, e.g., in which polypeptide (or membrane-associated polypeptide) is applied directly onto plates and binding of the test compound to the polypeptide is detected. Antibody or ligand binding to the polypeptide or complexes can also be detected in either format.

[0090]Interaction between molecules can also be assessed using real-time BIA (Biomolecular Interaction Analysis, e.g., using devices from Pharmacia Biosensor AB), which detect surface plasmon resonance (an optical phenomenon). Detection depends on changes in the mass concentration of macromolecules at the biospecific interface and does not require specific labeling of the molecules. In one useful embodiment, a library of test compounds can be immobilized on a sensor surface, e.g., a wall of a micro-flow cell. A solution containing the PC-1-L3 and/or PC-2-L1 polypeptide or complex is then continuously circulated over the sensor surface. An alteration in the resonance angle, as indicated on a signal recording, indicates the occurrence of an interaction. This general technique is described in more detail in the BIAtechnology Handbook by Pharmacia.

[0091]Optionally, the PC-1-L3 and/or PC-2-L1 polypeptide(s) is/are immobilized to facilitate separation of complexes between the polypeptide(s) and a test compound from uncomplexed forms of the polypeptide(s). This also facilitates automation of the assay. Complexation of polypeptide(s) with each other and/or the test compound can be achieved in any type of vessel, e.g., microtitre plates, microfluidic chambers or channels, microcentrifuge tubes and test tubes. In one embodiment, the PC-1-L3 and/or PC-2-L1 polypeptide is fused to another protein, e.g., glutathione-5-transferase to form a fusion protein which can be adsorbed onto a matrix, e.g., glutathione Sepharose.TM. beads (Sigma Chemical. St. Louis, Mo.), which are then combined with the test compound and incubated under conditions sufficient to form complexes. Subsequently, the beads are washed to remove unbound label, and the matrix is immobilized and the radiolabel is determined.

[0092]Similar methods for immobilizing proteins on matrices use biotin and streptavidin. For example, the proteins or complexes can be biotinylated using biotin NHS (N-hydroxy-succinimide), using well known techniques and immobilized in the well of streptavidin-coated plates.

[0093]Cell-free assays can also be used to identify tastants or other compounds (e.g., potential pH response modulators) that bind and/or modulate the activity of a PC-1-L3, PC-2-L1 or PC-1-L3/PC-2-L1 polypeptide or complex. In one embodiment, the polypeptide or complex is incubated with a test compound and a transmembrane ion channel activity of the polypeptide or complex is determined. In another embodiment, the binding affinity of the polypeptide or complex to a target molecule is determined by standard methods.

[0094]Further Details Regarding Cell Based Assays

[0095]In addition to cell-free assays such as those described above, the PC-1-L3 and/or PC-2-L1 polypeptide, and/or complex thereof can be used in cell-based assay for identifying compounds that bind to, activate and/or modulate polypeptide or complex activity.

[0096]For example, one method for identifying compounds that bind to PC-1-L3 and/or PC-2-L1 polypeptides or complexes comprises providing a cell that expresses one or both of these proteins, e.g., a human PC-1-L3 and/or PC-2-L1 polypeptide, combining a test compound with the cell and measuring the formation of a complex between the test compound and the polypeptide or polypeptide complex. The cell can be a mammalian cell (e.g., a CHO cell), a yeast cell, a bacterial cell, an insect cell, a Xenopus oocyte, a human or other mammalian taste cell, a kidney cell or any other cell expressing the PC-1-L3 and/or PC-2-L1 polypeptide, whether that expression is natural to the cell or the result of recombinant introduction of a PKD1L3 and/or PKD2L1 gene of interest. Further details regarding appropriate cells is found below.

[0097]In another embodiment, taste cells, kidney cells, neuronal cells, or cells expressing heterologous PC-1-L3 or PC-2-L1 polypeptides or complexes (e.g., recombinant CHO cells, recombinant insect cells, recombinant human cell line cells, etc.) or membrane preparations of such cells, can be utilized to screen for bioactivity of test compounds. The PC-2-L1 polypeptides described herein are Ca.sup.2+ permeable cation selective channels (pore forming channels). G-proteins such as PC-1-L3 interact with PC-2 proteins such as PC-2-L1. A variety of intracellular effectors have been identified as being Ca.sup.2+/G-protein regulated including, but not limited to, Ca.sup.2+-induced intraorganellar Ca.sup.2+ release by ryanodine and/or IP3 receptors, adenyl cyclase, cyclic GMP, phospholipase C, phospholipase A2 and phosphodiesterases, etc. Accordingly, the level of such second messengers produced by the aforementioned intracellular effectors, and thus activity of PC-1-L3 and/or PC-2-L1 polypeptides and/or polypeptide complexes, can be measured by techniques that are well known.

[0098]For example, the level of cAMP produced by activation of adenyl cyclase can be measured by assays which monitor cAMP, either in vivo by using FRET or transcriptional reporters sensitive to cAMP, or in vitro by directly measuring cAMP production. The GTPase activity by G proteins such as PC-1-L3 can be measured, e.g., in plasma membrane preparations by measuring the hydrolysis of gamma .sup.32P GTP, or in vivo by FRET or by monitoring activity of downstream effectors such as PLC, adenylate cyclase, etc. Breakdown of phosphatidylinositol-4,5-bisphosphate to 1,4,5-IP3 and diacylglycerol can be monitored by measuring the amount of diacylglycerol using thin-layer chromatography, or measuring the amount of IP3 using radiolabeling techniques or HPLC, or in vivo by activation of the IP3 receptor and release of calcium from internal stores. The generation of arachidonic acid by the activation of phospholipase A2 can be readily quantitated by well-known techniques.

[0099]Efflux of intracellular calcium or influx of calcium from outside the cell can be measured using conventional techniques, e.g., loading cells with a Ca.sup.+ sensitive fluorescent dye such as fura-2 or indol-1, and measuring any change in Ca.sup.++ using a fluorometer, such as Fluoskan Ascent Fluorescent Plate Reader or Fluorometric Imaging Plate Reader. The signal pathways initiated by PC-1-L3 and/or PC-2-L1 polypeptides or polypeptide complexes in response to sour, acid, base or other compounds can also be monitored by reporter gene assays.

[0100]Assays that monitor changes in membrane potential by (1) voltage measurements in Xenopus oocytes injected with mRNA encoding PC-1-L3 or PC-2-L1, (2) patch clamping in tissue culture cells expressing the receptor, and (3) fluorometric assays using voltage-sensitive dyes or ionic fluxes are preferred assays for monitoring membrane potential in the context of the present invention.

[0101]In other aspects, interactions between PC-1-L3, PC-2-L1 and/or related proteins (e.g., other polycystins) are monitored to detect activity or binding properties of the polypeptides or complexes thereof. For example, PC-2-like proteins (which are typically ion channels) often interact with PC-1-like proteins (which are typically G-proteins) to provide functional receptor complexes. Thus, in one aspect, interactions between polycystin-2L1 and polycystin-1L3 can be monitored. In addition, homodimers and heterodimers between different PC-1 and PC-2 proteins can exist. Accordingly, binding between PC-1-L3, PC-2-L1 and/or other polycystins can be monitored, e.g., by FRET or other protein-protein interaction technologies (cross-linking, etc.) to monitor homodimer and heterodimer formation, gating by PC-1 type or PC-2 type or related proteins, or the like.

[0102]As described, other assays such as melanophore assays, Phospholipase C assays, Ca.sup.++ mobilization assays, beta-arrestin FRET assays, and transcriptional reporter assays, e.g., using CRE, SRE, MRE, TRE, NFAT, and/or NFkB-response elements coupled to appropriate reporters can be used. Detection using reporter genes coupled to appropriate response elements are particularly convenient. For example, the coding sequence to chloramphenicol acetyl transferase, beta galactosidase or other convenient markers are coupled to a response element that is activated by a second messenger that is activated by a protein of the invention, e.g., through Ca.sup.++ release. Cells expressing the marker in response to application of an appropriate test compound are detected by cell survival, or by expression of a calorimetric marker, or the like, according to well established methods.

[0103]Any of a variety of potential modulators of PC-1-L3, PC-2-L1, PC-1-L3/PC-2-L1 or PKD1L3/PKD2L1 activity or expression can be screened for. For example, potential modulators (acids, bases, ions, sour/acid substitutes, small organic molecules, peptides, peptide mimetics, weak acids, CO.sub.2, acetic acid, blockers of carbonic anhydrase, MK-417, small molecules, organic molecules, inorganic molecules, proteins, hormones, transcription factors, or the like) can be contacted to a cell and an effect on PC-1-L3 and/or PC-2-L1 polypeptide(s) or complexes and/or PKD1L3 or PKD2L1 activity and/or expression monitored by any of the assays described herein or known in the art.

[0104]Furthermore, expression of PKD1L3 and/or PKD2L1 can be detected, e.g., via northern analysis or quantitative (e.g., real time) RT-PCR, before and/or after application of potential expression modulators. Similarly, promoter regions of PKD1L3 and/or PKD2L1 gene(s) of interest (e.g., generally sequences in the region of the start site of transcription, e.g., within 5 KB of the start site, e.g., 1 KB, or less e.g., within 500 BP or 250 BP or 100 BP of the start site) can be coupled to reporter constructs (CAT, beta-galactosidase, luciferase or any other available reporter) and can be similarly be tested for expression activity modulation by the potential modulator. In either case, the assays can be performed in a high-throughput fashion, e.g., using automated fluid handling and/or detection systems, in a serial or parallel fashion. Similarly, activity modulators can be tested by contacting a potential modulator to an appropriate cell using any of the activity detection methods herein, regardless of whether the activity that is detected is the result of activity modulation, expression modulation or both.

[0105]In any of the assays herein, control compounds can be administered and the activity of the control compounds compared to those of the test compounds to verify that changes in activity resulting from application of the test compound are not artifacts. For example, control compounds can include the various dyes, buffers, adjuvants, carriers, or the like that the test compounds are typically administered with, but lacking a putative test compound.

Details Regarding Transmembrane Potential Measurements and Transmembrane Dyes

[0106]As noted above, the invention optionally includes monitoring transmembrane potential (TM potential) to track ion channel activity of PC-1-13, PC-2-L1 or complexes thereof. In general, the distribution of a permeable ion between the inside and outside of a cell or other membrane depends on the transmembrane potential of the cell membrane. In particular, for ions separated by a semi-permeable membrane, the electrochemical potential difference (.DELTA..mu..sub.j) which exists across the membrane, is given by .DELTA..mu..sub.j=2.3 RT log [j.sub.I]/[j.sub.o]+zE.sub.RF, where R is the universal gas constant, T is an absolute temperature of the composition, F is Faraday's constant in coulombs, [j.sub.I] is the concentration of an ion (j) on an internal or intracellular side of the at least one membrane, [j.sub.o] is the concentration of j on an external or extracellular side of the at least one membrane, z is a valence of j and E.sub.R is a measured transmembrane potential. Thus, the calculated equilibrium potential difference (E.sub.j) for ion j=-2.3RT(zF).sup.-1 log [j.sub.I]/[j.sub.o] (this is often referred to as the "Nernst equation"). See, Selkurt, ed. (1984) Physiology 5.sup.th Edition, Chapters 1 and 2, Little, Brown, Boston, Mass. (ISBN 0-316-78038-3); Stryer (1995) Biochemistry 4.sup.th edition Chapters 11 and 12, W.H. Freeman and Company, NY (ISBN 0-7167-2009-4); Haugland (1996) Handbook of Fluorescent Probes and Research Chemicals Sixth Edition by Molecular Probes, Inc. (Eugene Oreg.) Chapter 25 (Molecular Probes, 1996) and http://www.probes.com/handbook/sections/2300.html (Chapter 23 of the on-line 1999 version of the Handbook of Fluorescent Probes and Research Chemicals Sixth Edition by Molecular Probes, Inc.) (Molecular Probes, 1999) and ille (1992) Ionic Channels of Excitable Membranes, second edition, Sinauer Associates Inc. Sunderland, Mass. (ISBN 0-87893-323-9) (Hille), for an introduction to transmembrane potential and the application of the Nernst equation to transmembrane potential. In addition to the Nernst equation, various calculations which factor in the membrane permeability of an ion, as well as Ohm's law, can be used to further refine the model of transmembrane potential difference, such as the "Goldman" or "constant field" equation and Gibbs-Donnan equilibrium. See Selkurt, ed. (1984) Physiology 5.sup.th Edition, Chapter 1, Little, Brown, Boston, Mass. (ISBN 0-3,6-78038-3) and Hille at e.g., chapters 10-13.

[0107]Increases and decreases in resting transmembrane potential--referred to as membrane depolarization and hyperpolarization, respectively--play a central role in many physiological processes, including ion-channel gating. Potentiometric optical probes (typically potentiometric dyes) provide a tool for measuring transmembrane potential and changes in transmembrane potential over time (e.g., transmembrane potential responses following the addition of a composition which affects transmembrane potential) in membrane containing structures such as organelles, cells and in vitro membrane preparations. In conjunction with probe imaging techniques (e.g., visualization of the relevant dyes), dye probes are used to map variations in transmembrane potential across cells membranes.

[0108]Potentiometric probes include cationic or zwitterionic styryl dyes, cationic rhodamines, anionic oxonols, hybrid oxonols and merocyanine 540. The class of dye determines factors such as accumulation in cells, response mechanism and cell toxicity. See, Molecular Probes 1999 and the reference cited therein; Plasek et al. (1996) "Indicators of Transmembrane potential: a Survey of Different Approaches to Probe Response Analysis." J Photochem Photobiol; Loew (1994) "Characterization of Potentiometric Membrane Dyes." Adv Chem Ser 235, 151 (1994); Wu and Cohen (1993) "Fast Multisite Optical Measurement of Transmembrane potential" Fluorescent and Luminescent Probes for Biological Activity, Mason, Ed., pp. 389-404; Loew (1993) "Potentiometric Membrane Dyes." Fluorescent and Luminescent Probes for Biological Activity, Mason, Ed., pp. 150-160; Smith (1990) "Potential-Sensitive Molecular Probes in Membranes of Bioenergetic Relevance." Biochim Biophys Acta 1016, 1; Gross and Loew (1989) "Fluorescent Indicators of Transmembrane potential: Microspectrofluorometry and Imaging." Meth Cell Biol 30, 193; Freedman and Novak (1989) "Optical Measurement of Transmembrane potential in Cells, Organelles, and Vesicles" Meth Enzymol 172, 102 (1989); Wilson and Chused (1985) "Lymphocyte Transmembrane potential and Ca.sup.+2-Sensitive Potassium Channels Described by Oxonol Dye Fluorescence Measurements" Journal of Cellular Physiology 125:72-81; Epps et al. (1993) "Characterization of the Steady State and Dynamic Fluorescence Properties of the Potential Sensitive dye bis-(1,3-dibutylbarbituric acid) trimethine oxonol (DiBAC.sub.4(3) in model systems and cells" Chemistry of Physics and Lipids 69:137-150, and Tanner et al. (1993) "Flow Cytometric Analysis of Altered Mononuclear Cell Transmembrane potential Induced by Cyclosporin" Cytometry 14:59-69.

[0109]Potentiometric dyes are typically divided into at least two categories based on their response mechanism. The first class of dyes, referred to as fast-response dyes (e.g., styrylpyridinium dyes; see, e.g., Molecular Probes (1999) at Section 23.2), operate by a change in the electronic structure of the dye, and consequently the fluorescence properties of the dye, i.e., in response to a change in an electric field which surrounds the dye. Optical response of these dyes is sufficiently fast to detect transient (millisecond) potential changes in excitable cells, e.g., isolated neurons, cardiac cells, and even intact brains. The magnitude of the potential-dependent fluorescence change is often small; fast-response probes typically show a 2-10% fluorescence change per 100 mV.

[0110]The second class of dyes, referred to as slow-response (or "Nernstian") dyes (See, e.g., Molecular Probes, 1999 at Section 23.3), exhibit potential-dependent changes in membrane distribution that are accompanied by a fluorescence change. The magnitude of their optical responses is typically larger than that of fast-response probes. Slow-response probes, which include cationic carbocyanines, rhodamines and anionic oxonols, are suitable for detecting changes in a variety of transmembrane potentials of, e.g., nonexcitable cells caused by a variety of biological phenomena, including ion channel permeability. The structures of a variety of available slow response dyes are found e.g., at table 25.3 of Molecular Probes (1996).

[0111]Many slow, Nemstian dyes such as carbocyanines, rhodamines and oxonols are used to measure transmembrane potential by virtue of voltage-dependent dye redistribution and fluorescence changes resulting from the redistribution. Fluorescence changes which may be caused by redistribution include: a change of the concentration of the fluorophore within the cell or vesicle, a change in the dye fluorescence due to aggregation or a change in dye fluorescence due to binding to intracellular or intravesicular sites. Typically, 10-15 minutes of equilibration time is used to allow the dyes to redistribute across the cell membrane after changing the transmembrane potential.

[0112]Examples of available anionic dyes that can be used for measurement of transmembrane potential include the anionic bis-isoxazolone oxonols which accumulate in the cytoplasm of depolarized cells by a Nernst equilibrium-dependent uptake from the extracellular solution. Of the oxonols studied in one reference ("Kinetics of the Potential-Sensitive Extrinsic Probe Oxonol VI in Beef Heart Submitochondrial Particles." J. C. Smith, B. Chance. J Membrane Biol 46, 255 (1979)), oxonol VI gave the largest spectral shifts, with an isosbestic point at 603 nm. Oxonol VI responds to changes in potential more rapidly than oxonol V.

[0113]The three common bis-barbituric acid oxonols, often referred to as DiBAC dyes, form a family of spectrally distinct potentiometric probes with excitation maxima at approximately 490 nm (DiBAC.sub.4(3), 530 nm (DiSBAC.sub.2(3)) and 590 nm (DiBAC.sub.4(5)). DiBAC.sub.4(3) has been used in many publications that cite using a "bis-oxonol" (Molecular Probes, 1999, chapter 23). The dyes enter depolarized cells where they bind to intracellular proteins or membranes and exhibit enhanced fluorescence and red spectral shifts. Increased depolarization results in more influx of the anionic dye and thus an increase in fluorescence. DiBAC.sub.4(3) has particularly high voltage sensitivity. The long-wavelength DiSBAC.sub.2(3) has frequently been used in combination with the UV light-excitable Ca.sup.2+ indicators indo-1 or fura-2 for the simultaneous measurements of transmembrane potential and Ca.sup.2+ concentrations (id. at Table 23.2).

[0114]Classes of cationic membrane permeable dyes that can be used as ion sensing compositions include, e.g., indo-carbocyanine dyes, thio-carbocyanine dyes, oxa-carbocyanine dyes (see Molecular Probes on-line catalogue, updated as of Aug. 10, 2000, at section 23.3, entitled "Slow-Response Dyes;" http://www.probes.com/handbook/sections/2303.html). See also, Sims, et al. (1974) "Studies on the Mechanism by Which Cyanine Dyes Measure Membrane Potential in Red Blood Cells and Phosphatidylcholine Vesicles," Biochemistry 13, 3315; Cabrini and Verkman (1986) "Potential-Sensitive Response Mechanism of DiS-C3(5) in Biological Membranes," Membrane Biol 92, 171; Guillet and Kimmich (1981) "DiO-C3-(5) and DiS-C3-(5): Interactions with RBC, Ghosts and Phospholipid Vesicles," J Membrane Biol 59, 1; Rottenberg and Wu (1998) "Quantitative Assay by Flow Cytometry of the Mitochondrial Membrane Potential in Intact Cells," Biochim Biophys Acta 1404, 393 (1998).

[0115]Other useful transmembrane dyes include amino napthylethylenyl pyridinium dyes, and dialkyl amino phenyl polyphenyl pyridinium dyes. The amino napthylethylenyl pyridinium dyes include the ANEP type dyes, e.g., listed in the Molecular Probes catalog (Di-4-ANEPPS, Di-8-ANEPPS, Di-2-ANEPEQ, Di-8-ANEPEQ and Di-12-ANEPEQ). Dialkyl amino phenyl polyphenyl pyridinium dyes include the RH type dyes listed in the Molecular Probes catalog (RH160, RH237, RH 421, RH 704, RH 414, and RH 461).

[0116]In general, changes in the level of fluorescence of the biological sample (e.g., containing PC-1-L3 and/or PC-2-L1 and/or coding nucleic acids)-test compound mixture are detected, where the change in fluorescence is indicative of a change in transmembrane potential. Typically, the assay methods described herein are used to detect the effect of the test compound on the transmembrane potential of a cell or other membrane. Where one is seeking to determine the effect of a test compound on a cell's transmembrane potential, e.g., through a change in ion flux, transport, membrane permeability, or the like, one can expose the cell, membrane, etc., to the test compound and the cell etc., is examined for the presence of a previously absent fluorescent signal (or the absence of a previously present fluorescent signal). Of particular interest are the effects of tastant compounds and potential modulators on cellular functioning, as determinable from TMP measurements.

[0117]For example, in one assay format, a dye is contacted to a biological sample. In accordance with these methods, the sample can be placed into a reaction vessel, such as a microwell dish, and the level of fluorescence from the composition is measured, optionally over a period of time. This can be used to provide an initial or background level of fluorescence indicative of an existing transmembrane potential for the biological sample. A selected test compound is then added to the biological sample (or these procedures are carried out in parallel, providing control and experimental samples). The test compound can be tested alone, or is added before, together or after addition of tastants to determine its effect on tastant responses (e.g. enhancement or inhibition). Following the stimulus, the fluorescence level of the biological sample is again measured (typically over time) and compared to the initial fluorescent level or the fluorescence level in a control cell population (e.g., which is exposed to a control TMP modulator). Any change in the level of fluorescence not attributable to dilution by the test compound (as determined from an appropriate control) is then attributable to the effect the test compound has on the cell's transmembrane potential, or rate of TMP change in response to depolarization or hyperpolarization events.

[0118]A suitable negative control can be used in the assay, such as a biological sample that does not include the PC-1-L3 and/or PC-2-L1 and/or coding nucleic acid(s), to ensure that the effect being observed is caused by the relevant protein or complex. Similarly, a suitable positive control can be used in the assay, such as a test compound known to effect the protein, gene or complex under study, to ensure that the biological sample components are suitably active.

[0119]In any case, these types of assays are optionally carried out in an appropriate reaction receptacle that allows measurement of fluorescence, in situ. As such, the receptacle is typically a transparent reaction vessel, such as a test tube, cuvette, a reaction well in a multiwell plate, or a transparent conduit, e.g., a capillary, microchannel or tube.

[0120]The assay methods of the present invention are particularly useful in performing high-throughput (greater than 1,000 compounds/day) and even ultra-high throughput (e.g., greater than 10,000 compounds/day) screening of chemical libraries, e.g., in searching for tastant/modulator leads. These experiments may be carried out in parallel by a providing a large number of reaction mixtures (e.g., cell suspensions as described herein) in separate receptacles, typically in a multiwell format, e.g., 96 well, 324 well or 1536 well plates. Different test compounds (library members) are added to separate wells, and the effect of the compound on the reaction mixture is ascertained, e.g., via the fluorescent signal. These parallelized assays are generally carried out using specialized equipment e.g., as described above to enable simultaneous processing of large numbers of samples, i.e., fluid handling by robotic pipettor systems and fluorescent detection by multiplexed fluorescent multi-well plate readers.

Patch Clamping

[0121]As noted above, monitoring of transmembrane dye flow is a preferred method of monitoring test compound effects on ion channels. A second preferred method uses voltage clamping, such as patch clamping. This is a particularly useful method e.g., when using Xenopus oocytes.

[0122]A voltage clamp allows for the measurement of ion currents flowing across a cell membrane. Originally, the voltage clamp used two electrodes and a feedback circuit for transmembrane measurements. In the original Cole-Marmount voltage clamp, both electrodes are placed inside a cell and transmembrane voltage is recorded through one of the electrodes (the "voltage electrode") relative to an outside reference (e.g., ground). The second electrode passes current into the cell and is termed the "current electrode".

[0123]Briefly, a "holding voltage" is maintained across the cell membrane. Anytime the cell makes a deviation from this holding voltage by passing an ion current across its membrane, an operational amplifier generates an "error signal". The error signal is the difference between the holding voltage specified by the experimenter and the actual voltage of the cell. The feedback circuit of the voltage clamp passes current into the cell (via the current electrode) in the polarity needed to reduce the error signal to zero. Thus, the current is applied in a polarity opposite current that the cell is passing across its membrane, and the clamp circuit provides a current that is the mirror image of the cellular current. This mirror or "clamp current" can be easily measured, giving an accurate reproduction of the currents flowing across the cell's membrane (although in the opposite polarity).

[0124]A modem variant of this general method is the "patch clamp" which uses a single electrode device. The patch clamp technique is in common use to monitor the flow of ions across a membrane (Neher E (1992) "Nobel lecture. Ion channels for communication between and within cells" Neuron. 8(4):605-12). The patch clamp technique involves applying a very finely drawn glass micropipette onto the surface of a cell to form an electrode. This electrode is pressed against a cell membrane and suction is applied to the inside of the electrode to pull the cell's membrane inside the tip of the electrode. This suction causes the cell to form a tight seal with the electrode (a "giga-ohm seal," as the electrical resistance of the seal is in excess of one giga-ohm). From this point, at least 4 different experimental approaches can be taken. First, the electrode can be left sealed to a patch of membrane (a "cell-attached patch"). This allows for the recording of currents through single ion channels in that patch of membrane. Second, the electrode can be withdrawn from the cell, ripping a patch of membrane off of the cell. This forms an "inside-out" patch. This is useful when the environment on the inside of an ion channel is to be studied. Third, the electrode can be withdrawn from the cell, allowing a blob of membrane to bud from the cell. When the electrode is pulled away, this blob will part from the cell and reform as a ball of membrane on the end of the electrode, with the outside of the membrane being the surface of the ball (thus the name "outside out patch"). Such "outside out" patching permits examination of the properties of an ion channel when it is protected from the outside environment, but not in contact with it's usual environment. Fourth, the electrode can be left in place, but harder suction is applied to rupture the portion of the cell's membrane that is inside the electrode, providing access to the intracellular space of the cell. This is known as "whole-cell recording". This method is also sometimes misnamed a "whole cell patch." The advantage of whole cell recording is that the sum total current that flows across the cell's membrane can be recorded.

[0125]Thus, the voltage clamping such as the patch clamp technique allows the recording of single ion-channel currents, or alternatively currents from entire small cells. In the context of the present invention, this provides a platform for the analysis of changes in currents that result from application of a test compound of modulator.

[0126]A modern variant of the classical patch clamp that can be adapted to the present invention is the planar patch clamp, which uses a planar array of PDMS electrodes that mimic a classical glass electrode (Klemic et al. (2002) "Micromolded PDMS Electrode Allows Patch Clamp Electrical Recording From Cells" Biosensors and Bioelectronics 597-604). This modern patch clamp is suited to high throughput patch clamp analysis, allowing many different cells to be analyzed for ion channel activity simultaneously. Patch clamp devices are also commercially available, e.g., from Axon Instruments.

Additional Screening System Details

[0127]Automated systems of the invention can facilitate the screening methods noted above (both in vitro and in vivo screening methods). That is, systems that facilitate cell or biochemical sample based screening for PC-1-L3, PC-2-L1, PKD1L3, or PKD2L1 expression and/or activity are a feature of the invention. Similarly, systems designed to monitor feeding/drinking/licking etc. behavior of animals, or physiological responses of animals (respiration rate, oxygen consumption, blood pH, etc.), including non-human transgenic laboratory animals, are also a feature of the invention. System features herein are generally applicable to the methods herein and vice-versa.

[0128]Biological/Biochemical Sources/Libraries

[0129]High-throughput automated systems that detect compounds that bind to and/or modulate an activity of PC-1-L3, or PC-2-L1 receptor polypeptide(s), or complex(es) thereof, typically include a biological/biochemical sample (that includes the taste receptor polypeptide or complex, e.g., any cell or other material described herein) and a source of a plurality of test compounds. A detector detects binding of one or more of the test compounds to the polypeptide or complex, or modulation of a level (e.g., complex formation) or activity of the polypeptide or complex (or mRNA transcript(s) corresponding to the polypeptide(s)) by the test compounds, thereby identifying a putative modulator, tastant compound, acid receptor binding moiety, etc., that binds to or modulates the activity of the polypeptide or complex.

[0130]The source of test compound for such systems and in the practice of the methods of the invention can be any commercially available or proprietary library of materials, including compound libraries from Senomyx (La Jolla, Calif.), Sigma (St. Louis Mo.), Aldrich (St. Louis Mo.), Agilent Technologies (Palo Alto, Calif.) or the like. The format of the library will vary depending on the system to be used. In one typical embodiment, libraries of sample materials are arrayed in microwell plates (e.g., 96, 384 or more well plates), which can be accessed by standard fluid handling robotics, e.g., using a pipettor or other fluid handler with a standard ORCA robot (Optimized Robot for Chemical Analysis) available from Beclaman Coulter (Fullerton, Calif.). Standard commercially available workstations such as the Caliper Life Sciences (Hopkinton, Mass.) Sciclone ALH 3000 workstation and Rapidplatem.TM. 96/384 workstation provide precise 96 and 384-well fluid transfers in a small, highly scalable format. Plate management systems such as the Caliper Life Sciences Twister.RTM. II Advanced Capability Microplate Handler for End-Users, OEM's and Integrators provide plate handling, storage and management capabilities for fluid handling, while the Presto.TM. AutoStack provides fast reliable access to consumables presenting trays of tips, reagents, microplates or deep wells to an automated device (e.g., the ALH 3000) without robotic arm intervention.

[0131]Microfluidic systems for handling and analyzing microscale fluid samples, including cell based and non-cell based approaches that can be used for analysis of test compounds on biological samples in the present invention are also available, e.g., the Caliper Life Sciences various LabChip.RTM. technologies (e.g., LabChip.RTM. 90 and 3000) and related Agilent Technologies (Palo Alto, Calif.) 2100 and 5100 devices. Similarly, interface devices between microfluidic and standard plate handling technologies are also commercially available. For example, the Caliper Technologies LabChip.RTM. 3000 uses "sipper chips" as a "chip-to-world" interface that allows automated sampling from microtiter plates. To meet the needs of high-throughput environments, the LabChip.RTM. 3000 employs four or even twelve sippers on a single chip so that samples can be processed, in parallel, up to twelve at a time. Solid phase libraries of materials can also be conveniently accessed using sipper or pipetting technology, e.g., solid phase libraries can be gridded on a surface and dried for later rehydration with a sipper or pipette and accessed through the sipper or pipette.

[0132]As already noted, with regard to the systems and methods of the invention, the particular libraries of compounds can be any of those that now exist, e.g., those that are commercially available, or that are proprietary. A number of libraries of test compounds exist, e.g., those from Senomyx (La Jolla, Calif.) (which include libraries pre-screened for desirable tastant properties), Sigma (St. Louis Mo.), and Aldrich (St. Louis Mo.). Other current compound library providers include Actimol (Newark Del.), providing e.g., the Actiprobe 10 and Actiprobe 25 libraries of 10,000 and 25,000 compounds, respectively; BioMol (Philedelphia, Pa.), providing a variety of libraries, including natural compound libraries and the Screen-Well.TM. Ion Channel ligand library which are usefully screened against the receptors herein, as well as several other application specific libraries; Enamine (Kiev, Ukranie) which produces custom libraries of billions of compounds from thousands of different building blocks, TimTec (Newark Del.), which produces general screening stock compound libraries containing >100,000 compounds, as well as template-based libraries with common heterocyclic lattices, libraries for targeted mechanism based selections, including kinase modulators, GPCR Ligands, channel modulators, etc., privileged structure libraries that include compounds containing chemical motifs that are more frequently associated with higher biological activity than other structures, diversity libraries that include compounds pre-selected from available stocks of compounds with maximum chemical diversity, plant extract libraries, natural products and natural product-derived libraries, etc; AnalytiCon Discovery (Germany) including NatDiverse (natural product analogue screening compounds) and MEGAbolite (natural product screening compounds); Chembridge (San Diego, Calif.) including a wide array of targeted or general and custom or stock libraries; ChemDiv (San Diego, Calif.) providing a variety of compound diversity libraries including CombiLab and the International Diversity Collection; Comgenix (Hungary) including ActiVerse.TM. libraries; MicroSource (Gaylordsville, Conn.) including natural libraries, agro libraries, the NINDS custom library, the genesis plus library and others; Polyphor (Switzerland) including privileged core structures as well as novel scaffolds; Prestwick Chemical (Washington D.C.), including the Prestwick chemical collection and others that are pre-screened for biotolerance; Tripos (St. Louis, Mo.), including large lead screening libraries; and many others. Academic institutions such as the Zelinsky Institute of Organic Chemistry (Russian Federation) also provide libraries of considerable structural diversity that can be screened in the methods of the invention.

[0133]Detectors and Other System Components

[0134]Although the devices and systems specifically illustrated herein are generally described in terms of the performance of a few or one particular operation, it will be readily appreciated from this disclosure that these systems permit easy integration of additional operations. For example, the systems described will optionally include structures, reagents and systems for performing virtually any number of operations both upstream and downstream from the operations specifically described herein. Such upstream operations include sample handling and preparation operations, e.g., cell separation, extraction, purification, culture, amplification, cellular activation, labeling reactions, dilution, aliquotting, and the like. Similarly, downstream operations may include similar operations, including, e.g., separation of sample components, labeling of components, assays and detection operations, movement of components into contact with cells or other membrane preparations, or materials released from cells or membrane preparations, or the like.

[0135]Upstream and downstream assay and detection operations include, without limitation, cell fluorescence assays, cell activity assays, receptor/ligand assays, immunoassays, and the like. Any of these elements can be fixed incorporated into the systems herein.

[0136]Instrumentation for high throughput optical screening of cell assays is available. In addition to the systems noted herein, other automated approaches can also be practiced with the dyes and methods of the invention. For example, the FLIPR (Fluorescence Imaging Plate Reader) was developed to perform quantitative optical screening for cell based kinetic assays (Schroder and Neagle (1996) "FLIPR: A New Instrument for Accurate, High Throughput Optical Screening" Journal of Biomolecular Screening 1(2):75-80). This device can be adapted to the present invention, e.g., by using dyes to monitor TMP, as discussed above.

[0137]In general in the present invention, materials such as cells and dyes are optionally monitored and/or detected so that an activity such as TMP activity can be determined. Depending on the label signal measurements, decisions can be made regarding subsequent operations, e.g., whether to assay a particular tastant/modulator in detail to determine detailed receptor binding/activity kinetic information.

[0138]The systems described herein generally include fluid handling devices, as described above, in conjunction with additional instrumentation for controlling fluid transport, flow rate and direction within the devices, detection instrumentation for detecting or sensing results of the operations performed by the system, processors, e.g., computers, for instructing the controlling instrumentation in accordance with preprogrammed instructions, receiving data from the detection instrumentation, and for analyzing, storing and interpreting the data, and providing the data and interpretations in a readily accessible reporting format. Patch clamps, or other features described herein are also optionally features of the invention.

[0139]Controllers

[0140]A variety of controlling instrumentation is optionally utilized in conjunction with the fluid handling elements described above, for controlling the transport and direction of fluids and/or materials (biological samples, test compounds, etc.) within the systems of the present invention. Controllers typically include appropriate software directing fluid and material transport in response to user instructions.

[0141]Typically, the controller systems are appropriately configured to receive or interface with a fluid handling or other system element as described herein. For example, the controller and/or detector, optionally includes a stage upon which a sample is mounted to facilitate appropriate interfacing between the controller and/or detector and the rest of the system. Typically, the stage includes an appropriate mounting/alignment structural elements, such as a nesting well, alignment pins and/or holes, asymmetric edge structures (e.g., to facilitate proper alignment of slides, microwell plates or microfluidic "chips"), and the like.

[0142]Detectors

[0143]Within the systems, detectors can take any of a variety of forms. The various fluid handling stations noted above often come with integrated detectors, e.g., optical or fluorescent detectors. However, other detectors such as patch clamp devices, fluorescence detectors that detects FRET, changes in membrane potential or flow of a dye into or out of the cell are also suitable, depending on the application.

[0144]Generally, devices herein optionally include signal detectors, e.g., which detect fluorescence, phosphorescence, radioactivity, pH, charge, absorbance, luminescence, temperature, magnetism or the like. As noted, fluorescent and patch clamp detection is especially preferred and generally used for detection of voltage changes, or flow of voltage sensitive compounds (however, as noted, upstream and downstream operations can be performed on cells, dyes, modulators or the like, which can involve other detection methods).

[0145]System signal detectors are typically disposed adjacent to a site of reaction or mixing between the biological/biochemical sample and the test compound. This site can be a test tube, microwell plate, microfluidic device, or the like. The site is within sensory communication of the detector. The phrase "within sensory communication" generally refers to the relative location of the detector that is positioned relative to the site so as to be able to receive a particular relevant signal from that container. In the case of optical detectors, e.g., fluorescence FRET, or fluorescence polarization detectors, sensory communication typically means that the detector is disposed sufficiently proximal to the container that optical, e.g., fluorescent signals, are transmitted to the detector for adequate detection of those signals. Typically this employs a lens, optical train or other detection element, e.g., a CCD, that is focused upon a relevant portion of the container to efficiently gather and record these optical signals.

[0146]Example detectors include patch-clamp stations, photo multiplier tubes, spectrophotometers, a CCD array, a scanning detector, a microscope, a galvo-scann or the like. Cells, dyes or other components which emit a detectable signal can be flowed past or moved into contact with the detector, or, alternatively, the detector can move relative to an array of samples (or, the detector can simultaneously monitor a number of spatial positions corresponding to samples, e.g., as in a CCD array).

[0147]The system typically includes a signal detector located proximal to the site of mixing/reaction. The signal detector detects the detectable signal, e.g., for a selected length of time (t). For example, the detector can include a spectrophotometer, or an optical detection element. Commonly, the signal detector is operably coupled to a computer, which deconvolves the detectable signal to provide an indication of the transmembrane potential, e.g., an indication of a change in the potential over time.

[0148]The detector can detect transmembrane potential (the work needed to move a unit of charge across a membrane such as a cell membrane), e.g., through a patch clamp, or by detecting flow of a cationic membrane permeable dye, an anionic Nernstian dye, an anionic membrane permeable dye, or other voltage sensing composition across the membrane over time, e.g., in response to application of a test compound. Changes in the rate of depolarization and hyperpolarization are monitored in response to a test compound, e.g., as compared to a control that does not include the test compound. Permeable dyes are particularly useful for monitoring ion flow, e.g., dyes that can equilibrate across the membrane relatively quickly, typically in about 1 hour, or less. Permeability can be dependent upon the relevant conditions, e.g., temperature, ionic conditions, voltage potentials, or the like.

[0149]Computer

[0150]Either or both of the controller system and/or the detection system are optionally coupled to an appropriately programmed processor or computer which functions to instruct the operation of these instruments in accordance with preprogrammed or user input instructions, receive data and information from these instruments, and interpret, manipulate and report this information to the user. As such, the computer is typically appropriately coupled to one or both of these instruments (e.g., including an analog to digital or digital to analog converter as needed).

[0151]The computer typically includes appropriate software for receiving user instructions, either in the form of user input into a set parameter fields, e.g., in a GUI, or in the form of preprogrammed instructions, e.g., preprogrammed for a variety of different specific operations. The software then converts these instructions to appropriate language for instructing the operation of the fluid direction and transport controller to carry out the desired operation. The computer then receives the data from the one or more sensors/detectors included within the system, and interprets the data, either provides it in a user understood format, or uses that data to initiate further controller instructions, in accordance with the programming, e.g., such as in monitoring and control of flow rates, temperatures, applied voltages, and the like.

[0152]In the present invention, the computer typically includes software for the monitoring of samples. Additionally, the software is optionally used to control flow of materials.

Biosensors

[0153]Biosensors of the invention are devices or systems that comprise PC-1-L3, PC-2-L1 and/or complexes thereof, coupled to a readout that measures or displays one or more activity of the polypeptide. Thus, any of the above described assay components can be configured as a biosensor by operably coupling the appropriate assay components to a readout. The readout can be optical (e.g., to detect cell markers, ion-sensitive dyes, cell potential, or cell survival) electrical (e.g., coupled to a PET, a BIAcore, or any of a variety of others), spectrographic, or the like, and can optionally include a user-viewable display (e.g., a CRT or optical viewing station). The biosensor can be coupled to robotics or other automation, e.g., microfluidic systems, that direct contact of the test compounds to the proteins of the invention, e.g., for automated high-throughput analysis of test compound activity. A large variety of automated systems that can be adapted to use with the biosensors of the invention are commercially available. For example, automated systems have been made to assess a variety of biological phenomena, including, e.g., expression levels of genes in response to selected stimuli (Service (1998) "Microchips Arrays Put DNA on the Spot" Science 282:396-399). Laboratory systems can also perform, e.g., repetitive fluid handling operations (e.g., pipetting) for transferring material to or from reagent storage systems that comprise arrays, such as microtiter trays or other chip trays, which are used as basic container elements for a variety of automated laboratory methods. Similarly, the systems manipulate, e.g., microtiter trays and control a variety of environmental conditions such as temperature, exposure to light or air, and the like. Many such automated systems are commercially available. Examples of automated systems are available from Caliper Technologies (including the former Zymark Corporation, Hopkinton, Mass.), which utilize various Zymate systems which typically include, e.g., robotics and fluid handling modules. Similarly, the common ORCA.RTM. robot, which is used in a variety of laboratory systems, e.g., for microtiter tray manipulation, is also commercially available, e.g., from Beckman Coulter, Inc. (Fullerton, Calif.). A number of automated approaches to high-throughput activity screening are provided by the Genomics Institute of the Novartis Foundation (La Jolla, Calif.); See GNF.org on the world-wide web. Microfluidic screening applications are also commercially available from Caliper Technologies Corp. For example, (e.g., LabMicrofluidic Device.RTM. high throughput screening system (HTS) by Caliper Technologies, Mountain View, Calif. or the HP/Agilent technologies Bioanalyzer using LabChip.TM. technology by Caliper Technologies Corp. can be adapted for use in the present invention.

[0154]In an alternate embodiment, conformational changes are detected by coupling the relevant polypeptide(s) or complex(es) to an electrical readout, e.g., to a chemically coupled field effect transistor (a CHEM-FET) or other appropriate system for detecting changes in conductance or other electrical properties brought about by a conformational shift by the protein of the invention.

Further Details Regarding Methods of Monitoring PC-1-L3 and/or PC-2-L1 Induced Behavior in Animal Models

[0155]In addition to the various biological and biochemical sample-based screening methods noted herein, the invention also encompasses testing for PC-1-L3/PKDL3 and/or PC-2-L1/PKD2L1 activity in response to test compounds, in vivo. In one embodiment, this is accomplished by introducing a heterologous PKD1-L3 and/or PKD2L1 taste receptor gene into an animal and expressing an encoded heterologous PC-1-L3 and/or PC-2-L1 taste receptor polypeptide in a taste bud of the animal or other relevant target for cellular expression (e.g., optionally including any cell or tissue type that naturally expresses PKD2L1 and/or PKD1L3). A putative PC-1-L3 and/or PC-2-L1 taste receptor tastant or modulator is provided to the animal, and one or more feeding behavior or physiological response of the animal is monitored in response to the presence of the putative PC-1-L3 and/or PC-2-L1 taste receptor tastant.

[0156]Optionally, the animal is a knock-out animal that has a reduced or eliminated function of an endogenous PKD1L3 and/or PKD2L1 gene and/or encoded polypeptide(s), e.g., in taste bud cells. Knock out animals are useful both for studies of PC-1-L3/PKDL3 and/or PC-2-L1/PKD2L1 function (for example, conformation that an animal lacking PC-1-L3/PKDL3 and/or PC-2-L1/PKD2L1 is deficient with respect to one or more taste perceptions or physiological, e.g., pH monitoring, responses) and as a target for delivery of a heterologous PKDL3 and/or PKD2L1 gene. That is, in one aspect, the animal is made transgenic with a PKD1L3 and/or PKD2L1 gene of interest. For example, a PKD1L3 and/or PKD2L1 knock-out mouse that comprises a human transgene for human PKD1L3 and/or PKD2L1 will display a response to tastants and modulators similar to a human, providing a good model system for studying response to tastants and modulators. Double knock outs of PKD2L1 and PKD1L3 are useful for providing both genes from a heterologous (e.g., human) source. The heterologous gene can be placed under the control of a heterologous promoter that is active in taste bud cells, e.g., a PKD1L3 and/or PKD2L1 promoter, a T1R-gene promoter, T2R-gene promoter, TRPM5-gene promoter, a PLCB2 gene promoter, a repeater gene promoter, a gustducin gene promoter, a Gi2 gene promoter, a cytokeratin-19 gene promoter, or another promoter for a gene that is naturally selectively expressed in a taste receptor cell of the tongue or palate epithelium.

[0157]Feeding behavior or physiological response(s) of the animal in response to putative tastants and/or modulators can be monitored by available methods. For example, animals (such as a transgenic PKD1L3 and/or PKD2L1 knock out mouse or other configuration as noted above that comprises a human PKD1L3 and/or PKD2L1 gene) will lick a device (stick, tube, plate, etc.) coated with a tastant, if the tastant is perceived as pleasurable to the animal. By monitoring increased or decreased licking behavior on such devices, the effect of a putative tastant or modulator on feeding behavior can be determined. Similarly, a putative tastant or modulator can be dissolved in a taste neutral fluid such as water and supplied to the animal (e.g., using a water bottle) to determine if drinking behavior increases, or if the fluid with the putative tastant is drunk preferentially to the neutral fluid (or avoided). For example, a neutrally flavored "control" can be a water bottle, while a test compound flavored "experimental" bottle can be placed in a control bottle. If the animal (mouse, rabbit, rat, etc.) feeds preferentially on the experimental bottle, then the animal can taste the test compound and perceives the flavor as pleasurable. If the experimental and control bottle are drunk equally, then the animal likely cannot taste the test compound. If the experimental bottle is drunk less than the control, then the animal can likely detect the test compound, and may detect it as being unpleasant. Similar experiments can be performed with a food source flavored with the test compound. Physiological responses that can be monitored in such animals also can include respiration rate, oxygen consumption, blood or urine pH, or the like. Measuring these responses utilizes standard techniques.

[0158]Modulatory activity can be similarly determined. That is, a potential modulator can be administered to the animal (e.g., applied to the taste bud, injected, or supplied in food or drink) and the increase or decrease in feeding/drinking/licking behavior towards a known tastant (e.g., a sour tastant) can be detected, and/or a physiological response can be detected, essentially as above. If administration of the modulator results in an increase in feeding/drinling/licling behavior towards the known tastant, then the modulator potentiates the response of that taste quality. If feeding/drinking/licking is decreased, then it likely inhibits activity of an attractive taste modality, or enhances activity of an aversive taste modality. Either activity can be useful, depending on whether an increase in feeding/drinking is desirable, e.g., to reduce adverse flavor effects of acid preservatives, or a decrease in feeding/drinking is desirable (e.g., to treat obesity, metabolic syndrome, high blood pressure, or the like by reducing calorie consumption). Examples of modulators include taste or pH receptor agonists, enhancers, antagonists, inverse agonists, etc.

Behavioral Systems

[0159]As noted, a further aspect of the invention monitors animal behavior upon application of potential tastants or taste cell modulators. These systems include a non-human animal comprising a heterologous PKD1L3 and/or PKD2L1 taste receptor gene that is expressed in a taste bud of the animal and a source of a putative tastant or modulator that is accessible (or administratable) to the animal. The system further includes a detector that detects a feeding behavior of the animal in response to the presence of the putative tastant or modulator.

[0160]Here again, the animal is typically a knock-out animal (e.g., a mouse) deficient in endogenous PC-1-L3 and/or PC-2-L1 taste receptor polypeptide expression, that expresses a heterologous human PC-1-L3 and/or PC-2-L1 taste receptor polypeptide. The source can include any of the configurations noted above with respect to the related methods, e.g., a lickable device, a fluid source comprising the tastant, or a food source comprising the tastant.

[0161]The detector will typically include a camera or motion sensor that monitors movement of the animal. Alternately, lickable devices can detect pressure against the device through conventional strain measurement devices, or electronically by detecting the completion of a circuit upon licking, or optically by detecting tongue movement. It is also possible to inset electrodes in muscles controlling oromotor activity and monitor their contraction/relaxation as a surrogate for feeding and gagging behavior.

[0162]An analysis module, e.g., a computer analyzes information from the detector and can statistically compile information regarding feeding/licking/drinking behavior. The analysis module can include a user viewable display that displays the results of the analysis to a user, e.g., a GUI.

Making Knock-Out Animals and Transgenics

[0163]Transgenic animals are a useful tool for studying gene function and testing tastants and modulators. Human (or other selected) PKD1L3 and/or PKD2L1 genes can be introduced in place of endogenous PKD1L3 and/or PKD2L1 genes of a laboratory animal, making it possible to study function of the human (or other) taste receptor in the easily manipulated and studied laboratory animal. It will be appreciated that there is not precise correspondence between receptor function of different animals (humans and mice perceive aspartame differently, for example), making the ability to study the human or other receptor of interest particularly useful. Although similar genetic manipulations can be performed in tissue culture, the interaction of PKD1L3 and/or PKD2L1 and/or PC-1-L3 and/or PC-2-L1 and/or complexes thereof, in the context of an intact organism, provides a more complete and physiologically relevant picture of PKD1L3/PKD2L1/PC-1-L3/PC-2-L1 function than can be achieved in simple cell-based screening assays. Accordingly, one feature of the invention is the creation of transgenic animals comprising heterologous PKD1L3 and/or PKD2L1 genes, e.g., which express these genes in the taste buds of the transgenic animal.

[0164]In general, such a transgenic animal is typically an animal that has had appropriate PKD1L3 and/or PKD9L2 genes (or partial genes, e.g., comprising coding sequences coupled to a promoter) introduced into one or more of its cells artificially. This is most commonly done in one of two ways. First, a DNA encoding PC-1-L3 and/or PC-2-L1 (or fragments thereof) can be integrated randomly by injecting it into the pronucleus of a fertilized ovum. In this case, the DNA can integrate anywhere in the genome. In this approach, there is no need for homology between the injected DNA and the host genome. Second, targeted insertion can be accomplished by introducing the (heterologous) DNA into embryonic stem (ES) cells and selecting for cells in which the heterologous DNA has undergone homologous recombination with homologous sequences of the cellular genome. Typically, there are several kilobases of homology between the heterologous and genomic DNA, and positive selectable markers (e.g., antibiotic resistance genes) are included in the heterologous DNA to provide for selection of transformants. In addition, negative selectable markers (e.g., "toxic" genes such as barnase) can be used to select against cells that have incorporated DNA by non-homologous recombination (i.e., random insertion).

[0165]One common use of targeted insertion of DNA is to make knock-out mice. Typically, homologous recombination is used to insert a selectable gene driven by a constitutive promoter into an essential exon of the gene that one wishes to disrupt (e.g., the first coding exon). To accomplish this, the selectable marker is flanked by large stretches of DNA that match the genomic sequences surrounding the desired insertion point. Once this construct is electroporated into ES cells, the cells' own machinery performs the homologous recombination. To make it possible to select against ES cells that incorporate DNA by non-homologous recombination, it is common for targeting constructs to include a negatively selectable gene outside the region intended to undergo recombination (typically the gene is cloned adjacent to the shorter of the two regions of genomic homology). Because DNA lying outside the regions of genomic homology is lost during homologous recombination, cells undergoing homologous recombination cannot be selected against, whereas cells undergoing random integration of DNA often can. A commonly used gene for negative selection is the herpes virus thymidine kinase gene, which confers sensitivity to the drug gancyclovir.

[0166]Following positive selection and negative selection if desired, ES cell clones are screened for incorporation of the construct into the correct genomic locus. Typically, one designs a targeting construct so that a band normally seen on a Southern blot or following PCR amplification becomes replaced by a band of a predicted size when homologous recombination occurs. Since ES cells are diploid, only one allele is usually altered by the recombination event so, when appropriate targeting has occurred, one usually sees bands representing both wild type and targeted alleles.

[0167]The embryonic stem (ES) cells that are used for targeted insertion are derived from the inner cell masses of blastocysts (early mouse embryos). These cells are pluripotent, meaning they can develop into any type of tissue.

[0168]Once positive ES clones have been grown up and frozen, the production of transgenic animals can begin. Donor females are mated, blastocysts are harvested, and several ES cells are injected into each blastocyst. Blastocysts are then implanted into a uterine horn of each recipient. By choosing an appropriate donor strain, the detection of chimeric offspring (i.e., those in which some fraction of tissue is derived from the transgenic ES cells) can be as simple as observing hair and/or eye color. If the transgenic ES cells do not contribute to the germline (sperm or eggs), the transgene cannot be passed on to offspring.

[0169]Further Details Regarding Cells Comprising PKD1L3/PKD2L1/PC-1-L3/PC-2-L1

[0170]As already noted, for several embodiments, biological samples to be tested for PKD1L3/PKD2L1 expression or PC-1-L3/PC-2-L1 expression or concentration are cells or are derived from cell preparations. The cells can be those associated with PKD1L3 and/or PKD2L1 and/or PC-1-L3 and/or PC-2-L1 expression in vivo, such as taste bud, nerve or kidney cells. Alternately, the cells can be derived from a taste bud, nerve or kidney cell, e.g., through culture.

[0171]However, one feature of the invention is the production of recombinant cells, e.g., expressing a heterologous PKD1L3 and/or PKD2L1 gene. It is worth noting that recombinant cells expressing both recombinant PKD1L3 and PKD2L1 are a feature of the invention that arises out of the determination that both genes are expressed in taste bud cells, which was not previously known.

[0172]In these recombinant cell embodiments, the biological sample to be tested is derived from the recombinant cell, which is selected largely for ease of culture and manipulation. The cells can be, e.g., human, rodent, insect, Xenopus, etc. and will typically be a cell in culture (or an oocyte in the case of Xenopus).

[0173]PKD1L3 and/or PKD2L1 nucleic acids are typically introduced into cells in cloning and/or expression vectors to facilitate introduction of the nucleic acid and expression of PKD1L3 and/or PKD2L1 to produce PC-1-L3 and/or PC-2-L1. Vectors include, e.g., plasmids, cosmids, viruses, YACs, bacteria, poly-lysine, etc. A "vector nucleic acid" is a nucleic acid molecule into which a heterologous nucleic acid is optionally inserted that can then be introduced into an appropriate host cell. Vectors preferably have one or more origins of replication, and one or more sites into which the recombinant DNA can be inserted. Vectors often have convenient means by which cells with vectors can be selected from those without, e.g., they encode drug resistance genes. Common vectors include plasmids, viral genomes, and (primarily in yeast and bacteria) artificial chromosomes. "Expression vectors" are vectors that comprise elements that provide for or facilitate transcription of nucleic acids which are cloned into the vectors. Such elements can include, e.g., promoters and/or enhancers operably coupled to a nucleic acid of interest.

[0174]In general, appropriate expression vectors are known in the art. For example, pET-14b, pcDNA1Amp, and pVL1392 are available from Novagen and Invitrogen and are suitable vectors for expression in E. coli, COS cells and baculovirus infected insect cells, respectively. pcDNA-3, pEAK, and vectors that permit the generation of PKD2L1 RNA for in vitro and in vivo expression experiments (e.g., in vitro translations and Xenopus oocyte injections) are also useful. These vectors are simply illustrative of those that are known in the art, with thousands of suitable vectors being available. Suitable host cells can be any cell capable of growth in a suitable media and allowing purification of an expressed protein. Examples of suitable host cells include bacterial cells, such as E. coli, Streptococci, Staphylococci, Streptomyces and Bacillus subtilis cells; fungal cells such as yeast cells, Pichia, and Aspergillus cells; insect cells such as Drosophila S2 and Spodoptera Sf9 cells, mammalian cells such as CHO, COS, and HeLa; and even plant cells.

[0175]Cells are transformed with PKD1L3 and/or PKD2L1 genes according to standard cloning and transformation methods. PC-1-L3 and PC-2-L1 can also be isolated from resulting recombinant cells using standard methods. General texts which describe molecular biological techniques for making nucleic acids, including the use of vectors, promoters and many other relevant topics, include Berger and Kimmel, Guide to Molecular Cloning Techniques, Methods in Enzymology volume 152 Academic Press, Inc., San Diego, Calif. (Berger); Sambrook et al., Molecular Cloning--A Laboratory Manual (3nd Ed.), Vol. 1-3, Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y., 2000 ("Sambrook") and Current Protocols in Molecular Biology, F. M. Ausubel et al., eds., Current Protocols, a joint venture between Greene Publishing Associates, Inc. and John Wiley & Sons, Inc., (supplemented through 2002) ("Ausubel")).

[0176]In addition, a plethora of kits are commercially available for the preparation, purification and cloning of plasmids or other relevant nucleic acids from cells, (see, e.g., EasyPrep.TM., FlexiPrep.TM., both from Pharmacia Biotech; StrataClean.TM., from Stratagene; and, QIAprep.TM. from Qiagen). Any isolated and/or purified nucleic acid can be further manipulated to produce other nucleic acids, used to transfect cells, incorporated into related vectors to infect organisms, or the like.

[0177]As noted, typical vectors contain transcription and translation terminators, transcription and translation initiation sequences, and promoters useful for regulation of the expression of the particular target nucleic acid. The vectors optionally comprise generic expression cassettes containing at least one independent terminator sequence, sequences permitting replication of the cassette in eukaryotes, or prokaryotes, or both, (e.g., shuttle vectors) and selection markers for both prokaryotic and eukaryotic systems. Vectors are suitable for replication and integration in prokaryotes, eukaryotes, or both. See, Giliman & Smith, Gene 8:81 (1979); Roberts, et al., Nature, 328:731 (1987); Schneider, B., et al., Protein Expr. Purif. 6435:10 (1995); Ausubel, Sambrook, Berger (above). A catalogue of Bacteria and Bacteriophages useful for cloning is provided, e.g., by the ATCC, e.g., The ATCC Catalogue of Bacteria and Bacteriophage published yearly by the ATCC. Additional basic procedures for sequencing, cloning and other aspects of molecular biology and underlying theoretical considerations are also found in Watson et al. (1992) Recombinant DNA Second Edition, Scientific American Books, NY.

[0178]In addition, essentially any nucleic acid (and virtually any labeled nucleic acid, whether standard or non-standard) can be custom or standard ordered from any of a variety of commercial sources, such as The Midland Certified Reagent Company (mcrc@oligos.com), The Great American Gene Company (www.genco.com), ExpressGen Inc. (www.expressgen.com), Operon Technologies Inc. (Alameda, Calif.) and many others.

[0179]Other useful references, e.g. for cell isolation and culture (e.g., for subsequent nucleic acid isolation) include Freshney (1994) Culture of Animal Cells, a Manual of Basic Technique, third edition, Wiley-Liss, New York and the references cited therein; Payne et al. (1992) Plant Cell and Tissue Culture in Liquid Systems John Wiley & Sons, Inc. New York, N.Y.; Gamborg and Phillips (eds) (1995) Plant Cell, Tissue and Organ Culture; Fundamental Methods Springer Lab Manual, Springer-Verlag (Berlin Heidelberg New York); and Atlas and Parks (eds) The Handbook of Microbiological Media (1993) CRC Press, Boca Raton, Fla.

Additional Details Regarding Protein Purification and Handling

[0180]Purification of PC-1-L3 and/or PC-2-L1, and/or complexes thereof can be accomplished using known techniques. In one embodiment, transformed cells expressing PC-1-L3 and/or PC-2-L1 are lysed, crude purification occurs to remove debris and some contaminating proteins, followed by chromatography to further purify the protein to the desired level of purity. Because the proteins are membrane proteins, membrane fractions comprising the proteins can similarly be purified, if desired. Cells can be lysed by known techniques such as homogenization, sonication, detergent lysis and freeze-thaw techniques. Crude purification can occur using ammonium sulfate precipitation, centrifugation or other known techniques. Suitable chromatography includes anion exchange, cation exchange, high performance liquid chromatography HPLC), gel filtration, affinity chromatography, hydrophobic interaction chromatography, etc. Well known techniques for refolding proteins can be used to obtain the active conformation of the protein when the protein is denatured during intracellular synthesis, isolation or purification.

[0181]In general, polycystin 2L1 polypeptides, can be purified, either partially (e.g., achieving a 5.times., 10.times., 100.times., 500.times., or 1000.times. or greater purification), or even substantially to homogeneity (e.g., where the protein is the main component of a solution, typically excluding the solvent (e.g., water or DMSO) and buffer components (e.g., salts and stabilizers) that the polypeptide is suspended in, e.g., if the polypeptide is in a liquid phase), according to standard procedures known to and used by those of skill in the art. Accordingly, polypeptides of the invention can be recovered and purified by any of a number of methods well known in the art, including, e.g., ammonium sulfate or ethanol precipitation, acid or base extraction, column chromatography, affinity column chromatography, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, hydroxylapatite chromatography, lectin chromatography, gel electrophoresis and the like. Protein refolding steps can be used, as desired, in making correctly folded mature proteins. High performance liquid chromatography (HPLC), affinity chromatography or other suitable methods can be employed in final purification steps where high purity is desired. In one embodiment, antibodies made against polycyctin 2L1 are used as purification reagents, e.g., for affinity-based purification. Once purified, partially or to homogeneity, as desired, the polypeptides are optionally used e.g., as assay components, therapeutic reagents or as immunogens for antibody production.

[0182]In addition to other references noted herein, a variety of purification/protein purification methods are well known in the art, including, e.g., those set forth in R. Scopes, Protein Purification, Springer-Verlag, N.Y. (1982); Deutscher, Methods in Enzmmology Vol. 182: Guide to Protein Purification, Academic Press, Inc. N.Y. (1990); Sandana (1997) Bioseparation of Proteins, Academic Press, Inc.; Bollag et al. (1996) Protein Methods, 2nd Edition Wiley-Liss, NY; Walker (1996) The Protein Protocols Handbook Humana Press, NJ; Harris and Angal (1990) Protein Purification Applications: A Practical Approach IRL Press at Oxford, Oxford, England; Harris and Angal Protein Purification Methods: A Practical Approach IRL Press at Oxford, Oxford, England; Scopes (1993) Protein Purification: Principles and Practice 3rd Edition Springer Verlag, NY; Janson and Ryden (1998) Protein Purification: Principles, High Resolution Methods and Applications, Second Edition Wiley-VCH, NY; and Walker (1998) Protein Protocols on CD-ROM Humana Press, NJ; and the references cited therein.

[0183]Those of skill in the art will recognize that, after synthesis, expression and/or purification, proteins can possess a conformation different from the desired conformations of the relevant polypeptides. For example, polypeptides produced by prokaryotic systems often are optimized by exposure to chaotropic agents to achieve proper folding. During purification from, e.g., lysates derived from E. coli, the expressed protein is optionally denatured and then renatured. This is accomplished, e.g., by solubilizing the proteins in a chaotropic agent such as guanidine HCl. In general, it is occasionally desirable to denature and reduce expressed polypeptides and then to cause the polypeptides to re-fold into the preferred conformation. For example, guanidine, urea, DTT, DTE, and/or a chaperonin can be added to a translation product of interest. Methods of reducing, denaturing and renaturing proteins are well known to those of skill in the art (see, the references above, and Debinski, et al. (1993) J. Biol. Chem., 268: 14065-14070; Kreitman and Pastan (1993) Bioconjug. Chem., 4: 581-585; and Buchner, et al., (1992) Anal. Biochem., 205: 263-270). Debinski, et al., for example, describe the denaturation and reduction of inclusion body proteins in guanidine-DTE. The proteins can be refolded in a redox buffer containing, e.g., oxidized glutathione and L-arginine. Refolding reagents can be flowed or otherwise moved into contact with the one or more polypeptide or other expression product, or vice-versa.

[0184]PKD1L3 and/or PKD2L1 nucleic acids optionally comprise a coding sequence fused in-frame to a marker sequence which, e.g., facilitates purification of the encoded polypeptide. Such purification facilitating domains include, but are not limited to, metal chelating peptides such as histidine-tryptophan modules that allow purification on immobilized metals, a sequence which binds glutathione (e.g., GST), a hemagglutinin (HA) tag (corresponding to an epitope derived from the influenza hemagglutinin protein; Wilson, I., et al. (1984) Cell 37:767), maltose binding protein sequences, the FLAG epitope utilized in the FLAGS extension/affinity purification system (Immunex Corp, Seattle, Wash.), and the like. The inclusion of a protease-cleavable polypeptide linker sequence between the purification domain and the sequence of the invention is useful to facilitate purification.

Cell Rescue--Treatement

[0185]In one aspect, the invention includes rescue of a cell that is defective in function of one or more endogenous polycystin genes (e.g., PKD1L3 and/or PKD2L1) or polypeptides (e.g., PC-1-L3 and/or PC-2-L1) or complexes thereof. This can be accomplished simply by introducing a new copy of the gene(s) (or a heterologous nucleic acid(s) that expresses the relevant protein(s)) into a cell. Other approaches, such as homologous recombination to repair the defective gene (e.g., via chimeraplasty) can also be performed. In any event, rescue of function can be measured, e.g., in any of the assays noted herein. Indeed, this can be used as a general method of screening cells in vitro for activity. Accordingly, in vitro rescue of function is useful in this context for the myriad in vitro screening methods noted above, e.g., for the identification of tastants or modulators in cells. The cells that are rescued can include cells in culture, (including primary or secondary cell culture from patients, as well as cultures of well-established cells). Where the cells are isolated from a patient, this has additional diagnostic utility in establishing which sequence is defective in a patient that presents with a tasting defect.

[0186]In another aspect, cell rescue occurs in a patient, e.g., a human or veterinary patient, e.g., to remedy a tastant or pH sensor defect. Thus, one aspect of the invention is gene therapy to remedy tasting or pH sensing defects (or even simply to enhance tastant discrimination), in human or veterinary applications. In these applications, the nucleic acids of the invention are optionally cloned into appropriate gene therapy vectors (and/or are simply delivered as naked or liposome-conjugated nucleic acids), which are then delivered (generally topically to the taste buds, but optionally systemically), optionally in combination with appropriate carriers or delivery agents. Proteins can also be delivered directly, but delivery of the nucleic acid is typically preferred in applications where stable expression is desired.

[0187]Vectors for administration typically comprise PKD1L3 and/or PKD2L1 genes under the control of a promoter that is expressed in taste bud cells. These can include native PKD1L3 or PKD2L1 promoters, or other taste bud specific promoters such as a T1R-gene promoter, a T2R-- gene promoter, a TRPM5-gene promoter, a PLCB2 gene promoter, a repeater gene promoter, a gustducin gene promoter, a Gi2 gene promoter, a cytokeratin-19 gene promoter, or a promoters for another gene that is naturally selectively expressed in a taste receptor cell of the tongue or palate epithelium. In the case of expression in neuronal cells (e.g., in contact with the CSF), a variety of genes are known to be promiscuously expressed in central or peripheral neurons. For example, Gray P A Fu H et al (2004) "Mouse Brain Organization Revealed through Direct Genome Scale Transcription Factor Expression Analysis." Science 306:2255-57 describe genes that can be used as sources of promoters. Similarly, Ruan et al (2005) "Nuclear receptors and their coregulators in kidney" Kidney Int. 68(6):2444-61 describe appropriate sources of promoters for expression in kidney.

[0188]Compositions for administration, e.g., comprise a therapeutically effective amount of the gene therapy vector or other relevant nucleic acid, and a pharmaceutically acceptable carrier or excipient. Such a carrier or excipient includes, but is not limited to, saline, buffered saline, dextrose, water, glycerol, ethanol, and/or combinations thereof. The formulation is made to suit the mode of administration. In general, methods of administering gene therapy vectors for topical use are well known in the art and can be applied to administration of the nucleic acids of the invention.

[0189]Therapeutic compositions comprising one or more nucleic acid of the invention are optionally tested in one or more appropriate in vitro and/or in vivo animal model of disease, to confirm efficacy, tissue metabolism, and to estimate dosages, according to methods well known in the art. In particular, dosages can initially be determined by activity, stability or other suitable measures of the formulation.

[0190]Administration is by any of the routes normally used for introducing a molecule into ultimate contact with cells of interest (taste bud, tongue, palate epithelium, neuronal cells, kidney cells, etc.). Practitioners can select an administration route of interest based on the cell target. For example, topical administration or direct injection into the taste buds or other tissues of the tongue or palette epithelium is simplest and therefore preferred for these targets. Similarly, injection into the CSF can be used where the target is neuronal cells in contact with the CSF. The nucleic acids of the invention are administered in any suitable manner, optionally with one or more pharmaceutically acceptable carriers. Suitable methods of administering such nucleic acids in the context of the present invention to a patient are available, and, although more than one route can be used to administer a particular composition, a particular route can often provide a more immediate and more effective action or reaction than another route.

[0191]Pharmaceutically acceptable carriers are determined in part by the particular composition being administered, as well as by the particular method used to administer the composition. Accordingly, there is a wide variety of suitable formulations of pharmaceutical compositions of the present invention. Compositions can be administered by a number of routes including, but not limited to: oral (in this case, topical and oral can be the same or different, e.g., topical delivery to the taste buds can be oral, as can systemic administration by the GI tract), intravenous, intraperitoneal, intramuscular, transdermal, subcutaneous, topical, sublingual, spinal or rectal administration. Compositions can be administered via liposomes (e.g., topically), or via topical delivery of naked DNA or viral vectors. Such administration routes and appropriate formulations are generally known to those of skill in the art.

[0192]The compositions, alone or in combination with other suitable components, can also be made into aerosol formulations (i.e., they can be "nebulized") to be administered via inhalation. Aerosol formulations can be placed into pressurized acceptable propellants, such as dichlorodifluoromethane, propane, nitrogen, and the like. Formulations suitable for parenteral administration, such as, for example, by intraarticular (in the joints), intravenous, intramuscular, intradermal, intraperitoneal, and subcutaneous routes, include aqueous and non-aqueous, isotonic sterile injection solutions, which can contain antioxidants, buffers, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient, and aqueous and non-aqueous sterile suspensions that can include suspending agents, solubilizers, thickening agents, stabilizers, and preservatives. The formulations of packaged nucleic acid can be presented in unit-dose or multi-dose sealed containers, such as ampules and vials.

[0193]The dose administered to a patient, in the context of the present invention, is sufficient to effect a beneficial therapeutic response in the patient over time, or, e.g., to provide sweet or glutamate tastant discrimination as perceived by the patient in an objective sweet or glutamate tastant test. The dose is determined by the efficacy of the particular vector, or other formulation, and the activity, stability or serum half-life of the polypeptide which is expressed, and the condition of the patient, as well as the body weight or surface area of the patient to be treated. The size of the dose is also determined by the existence, nature, and extent of any adverse side-effects that accompany the administration of a particular vector, formulation, or the like in a particular patient. In determining the effective amount of the vector or formulation to be administered in the treatment of disease, the physician evaluates local expression in the taste buds, or circulating plasma levels, formulation toxicities, progression of the relevant disease, and/or where relevant, the production of antibodies to proteins encoded by the polynucleotides. The dose administered, e.g., to a 70 kilogram patient are typically in the range equivalent to dosages of currently-used therapeutic proteins, adjusted for the altered activity or serum half-life of the relevant composition. The vectors of this invention can supplement treatment conditions by any known conventional therapy (e.g., diet restriction, etc.).

[0194]For administration, formulations of the present invention are administered at a rate determined by the ILD-50 of the relevant formulation, and/or observation of any side-effects of the vectors of the invention at various concentrations, e.g., as applied to the mass or topical delivery area and overall health of the patient. Administration can be accomplished via single or divided doses.

[0195]If a patient undergoing treatment develops fevers, chills, or muscle aches, he/she receives the appropriate dose of aspirin, ibuprofen, acetaminophen or other pain/fever controlling drug. Patients who experience reactions to the compositions, such as fever, muscle aches, and chills are premedicated 30 minutes prior to the future infusions with either aspirin, acetaminophen, or, e.g., diphenhydramine. Meperidine is used for more severe chills and muscle aches that do not quickly respond to antipyretics and antihistainines. Treatment is slowed or discontinued depending upon the severity of the reaction.

Detecting Polymorphisms

[0196]In one aspect, the invention includes detecting a polymorphism in a PKD1L3 and/or PKD2L1 gene (or a nucleic acid in linkage disequilibrium with such a polymorphism) to detect a taste receptor abnormality. A "polymorphism" is a locus that is variable; that is, within a population, the nucleotide sequence at a polymorphism has more than one version or allele. The term "allele" refers to one of two or more different nucleotide sequences that occur or are encoded at a specific locus, or two or more different polypeptide sequences encoded by such a locus. For example, a first allele can occur on one chromosome, while a second allele occurs on a second homologous chromosome, e.g., as occurs for different chromosomes of a heterozygous individual, or between different homozygous or heterozygous individuals in a population. One example of a polymorphism is a "single nucleotide polymorphism" (SNP), which is a polymorphism at a single nucleotide position in a genome (the nucleotide at the specified position varies between individuals or populations). An allele "positively" correlates with a trait when it is linked to it and when presence of the allele is an indictor that the trait or trait form will occur in an individual comprising the allele. An allele negatively correlates with a trait when it is linked to it and when presence of the allele is an indicator that a trait or trait form will not occur in an individual comprising the allele.

[0197]In the present case, the gene for tastant defects is identified (PKD1L3 and/or PKD2L1). Polymorphisms within or linked to (in linkage disequilibrium with) the gene likely correlate to altered taste perception. Thus, tastant defects or abnormalities can be detected by detecting polymorphisms in the gene.

[0198]In general, markers corresponding to polymorphisms between members of a population can be detected by numerous methods well-established in the art (e.g., PCR-based sequence specific amplification, restriction fragment length polymorphisms (RFLPs), isozyme markers, northern analysis, allele specific hybridization (ASH), array based hybridization, amplified variable sequences of the genome, self-sustained sequence replication, simple sequence repeat (SSR), single nucleotide polymorphism (SNP), random amplified polymorphic DNA ("RAPD") or amplified fragment length polymorphisms (AFLP). In one additional embodiment, the presence or absence of a molecular marker is determined simply through nucleotide sequencing of the polymorphic marker region. Any of these methods are readily adapted to high throughput analysis.

Additional Details Regarding Sequence Variations

[0199]A number of particular PC-1-L3 and PC-2-L1 polypeptides and coding nucleic acids are described herein by sequence (See, e.g., the Examples section below; see also, co-pending application U.S. Ser. No. 11/176,958). These polypeptides and coding nucleic acids can be modified, e.g., by mutation as described herein, or simply by artificial synthesis of a desired variant. Several types of example variants are described below.

[0200]Splice Variants

[0201]Given the significant number of exons found in PKD1L3 and PKD2L1, the presence of splice variants in taste receptor cells is likely. These can be expressed alone or in combination and can be detected or monitored by analysis of taste cell mRNA using PKD1L3 and/or PKD2L1 exon-specific primers and the polymerase chain reaction.

[0202]Silent Variations

[0203]Due to the degeneracy of the genetic code, any of a variety of nucleic acids sequences encoding polypeptides of the invention are optionally produced, some which can bear lower levels of sequence identity to the PKD2L1 nucleic acids in the Examples below.

[0204]The following provides a typical codon table specifying the genetic code, found in many biology and biochemistry texts.

TABLE-US-00001 TABLE 1 Codon Table Amino acids Codon Alanine Ala A GCA GCC GCG GCU Cysteine Cys C UGC UGU Aspartic acid Asp D GAC GAU Glutamic acid Glu E GAA GAG Phenylalanine Phe F UUC UUU Glycine Gly G GGA GGC GGG GGU Histidine His H CAC CAU Isoleucine Ile I AUA AUC AUU Lysine Lys K AAA AAG Leucine Leu L UUA UUG CUA CUC CUG CUU Methionine Met M AUG Asparagine Asn N AAC AAU Proline Pro P CCA CCC CCG CCU Glutamine Gln Q CAA CAG Arginine Arg R AGA AGG CGA CGC CGG CGU Serine Ser S AGC AGU UCA UCC UCG UCU Threonine Thr T ACA ACC ACG ACU Valine Val V GUA GUC GUG GUU Tryptophan Trp W UGG Tyrosine Tyr Y UAC UAU

[0205]The codon table shows that many amino acids are encoded by more than one codon. For example, the codons AGA, AGG, CGA, CGC, CGG, and CGU all encode the amino acid arginine. Thus, at every position in the nucleic acids of the invention where an arginine is specified by a codon, the codon can be altered to any of the corresponding codons described above without altering the encoded polypeptide. It is understood that U in an RNA sequence corresponds to T in a DNA sequence.

[0206]Such "silent variations" are one species of "conservatively modified variations", discussed below. One of skill will recognize that each codon in a nucleic acid (except ATG, which is ordinarily the only codon for methionine) can be modified by standard techniques to encode a functionally identical polypeptide. Accordingly, each silent variation of a nucleic acid which encodes a polypeptide is implicit in any described sequence. The invention, therefore, explicitly provides each and every possible variation of a nucleic acid sequence encoding a polypeptide of the invention that could be made by selecting combinations based on possible codon choices. These combinations are made in accordance with the standard triplet genetic code (e.g., as set forth in Table 1, or as is commonly available in the art) as applied to the nucleic acid sequence encoding a polycystin polypeptide of the invention. All such variations of every nucleic acid herein are specifically provided and described by consideration of the sequence in combination with the genetic code. One of skill is fully able to make these silent substitutions using the methods herein.

[0207]Conservative Variations

[0208]"Conservatively modified variations" or, simply, "conservative variations" of a particular nucleic acid sequence or polypeptide are those which encode identical or essentially identical amino acid sequences. One of skill will recognize that individual substitutions, deletions or additions which alter, add or delete a single amino acid or a small percentage of amino acids (typically less than 5%, more typically less than 4%, 2% or 1%) in an encoded sequence are "conservatively modified variations" where the alterations result in the deletion of an amino acid, addition of an amino acid, or substitution of an amino acid with a chemically similar amino acid.

[0209]Conservative substitution tables providing functionally similar amino acids are well known in the art. Table 2 sets forth six groups which contain amino acids that are "conservative substitutions" for one another.

TABLE-US-00002 TABLE 2 Conservative Substitution Groups 1 Alanine (A) Serine (S) Threonine (T) 2 Aspartic acid (D) Glutamic acid (E) 3 Asparagine (N) Glutamine (Q) 4 Arginine (R) Lysine (K) 5 Isoleucine (I) Leucine (L) Methionine (M) Valine (V) 6 Phenylalanine (F) Tyrosine (Y) Tryptophan (W)

[0210]Thus, "conservatively substituted variations" of a listed polypeptide sequence of the present invention include substitutions of a small percentage, typically less than 5%, more typically less than 2% or 1%, of the amino acids of the polypeptide sequence, with a conservatively selected amino acid of the same conservative substitution group.

[0211]Finally, the addition or deletion of sequences which do not alter the encoded activity of a nucleic acid molecule, such as the addition or deletion of a non-functional sequence (or, e.g., a tagging sequence added to facilitate purification), is a conservative variation of the basic nucleic acid or polypeptide.

[0212]One of skill will appreciate that many conservative variations of the nucleic acid constructs which are disclosed yield a functionally identical construct. For example, as discussed above, owing to the degeneracy of the genetic code, "silent substitutions" (i.e., substitutions in a nucleic acid sequence which do not result in an alteration in an encoded polypeptide) are an implied feature of every nucleic acid sequence which encodes an amino acid. Similarly, "conservative amino acid substitutions," in one or a few amino acids in an amino acid sequence are substituted with different amino acids with highly similar properties, are also readily identified as being highly similar to a disclosed construct. Such conservative variations of each disclosed sequence are a feature of the present invention.

[0213]Antibodies

[0214]In another aspect, antibodies to PC-1-L3 and/or PC-2-L1 and/or complexes thereof, can be generated using methods that are well known. The antibodies can be utilized for detecting and/or purifying PC-1-L3 and/or PC-2-L1 and/or complexes thereof e.g., in situ to monitor localization of receptor, or simply in a biological sample of interest. Antibodies can optionally discriminate the PC-1-L3 and/or PC-2-L1 and/or complexes thereof from various other polycystin homologues, and/or can be used in biosensor applications. Antibodies can also be used to block function of polycystin-2L1 and/or polycystin-1L3, and/or complexes thereof, in vivo, in situ or in vitro. As used herein, the term "antibody" includes, but is not limited to, polyclonal antibodies, monoclonal antibodies, humanized or chimeric antibodies and biologically functional antibody fragments, which are those fragments sufficient for binding of the antibody fragment to the protein.

[0215]For the production of antibodies to a relevant polypeptide or complex, e.g., encoded by one of any disclosed or available sequences or conservative variant or fragment thereof for PKD1L3, PKD2L1, PC-1-L3 or PC-2-L1, various host animals maybe immunized by injection with the polypeptide, or a portion thereof. Such host animals may include, but are not limited to, rabbits, mice and rats, to name but a few. Various adjuvants may be used to enhance the immunological response, depending on the host species, including, but not limited to, Freund's (complete and incomplete), mineral gels such as aluminum hydroxide, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanin, dinitrophenol, and potentially useful human adjuvants such as BCG (bacille Calmette-Guerin) and Corynebacterium parvum.

[0216]Polyclonal antibodies are heterogeneous populations of antibody molecules derived from the sera of animals immunized with an antigen, such as target gene product, or an antigenic functional derivative thereof. For the production of polyclonal antibodies, host animals, such as those described above, may be immunized by injection with the encoded protein, or a portion thereof, supplemented with adjuvants as also described above.

[0217]Monoclonal antibodies (mAbs), which are homogeneous populations of antibodies to a particular antigen, may be obtained by any technique which provides for the production of antibody molecules by continuous cell lines in culture. These include, but are not limited to, the hybridoma technique of Kohler and Milstein (Nature 256:495-497, 1975; and U.S. Pat. No. 4,376,110), the human B-cell hybridoma technique (Kosbor et al., Immunology Today 4:72, 1983; Cole et al., Proc. Nat'l. Acad. Sci. USA 80:2026-2030, 1983), and the EBV-hybridoma technique (Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc., pp. 77-96, 1985). Such antibodies may be of any immunoglobulin class, including IgG, IgM, IgE, IgA, IgD, and any subclass thereof. The hybridoma producing the mAb of this invention may be cultivated in vitro or in vivo. Production of high titers of mAbs in vivo makes this the presently preferred method of production.

[0218]In addition, techniques developed for the production of "chimeric antibodies" (Morrison et al., Proc. Nat'l. Acad. Sci. USA 81:6851-6855, 1984; Neuberger et al., Nature 312:604-608, 1984; Takeda et al., Nature 314:452-454, 1985) by splicing the genes from a mouse antibody molecule of appropriate antigen specificity, together with genes from a human antibody molecule of appropriate biological activity, can be used. A chimeric antibody is a molecule in which different portions are derived from different animal species, such as those having a variable or hypervariable region derived from a murine mAb and a human immunoglobulin constant region.

[0219]Alternatively, techniques described for the production of single-chain antibodies (U.S. Pat. No. 4,946,778; Bird, Science 242:423-426, 1988; Huston et al., Proc. Nat'l. Acad. Sci. USA 85:5879-5883, 1988; and Ward et al., Nature 334:544-546, 1989) can be adapted to produce differentially expressed gene-single chain antibodies. Single chain antibodies are formed by linking the heavy and light chain fragments of the Fv region via an amino acid bridge, resulting in a single-chain polypeptide.

[0220]In one aspect, techniques useful for the production of "humanized antibodies" can be adapted to produce antibodies to the proteins, fragments or derivatives thereof. Such techniques are disclosed in U.S. Pat. Nos. 5,932,448; 5,693,762; 5,693,761; 5,585,089; 5,530,101; 5,569,825; 5,625,126; 5,633,425; 5,789,650; 5,661,016; and 5,770,429.

[0221]Antibody fragments which recognize specific epitopes may be generated by known techniques. For example, such fragments include, but are not limited to, the F(ab').sub.2 fragments, which can be produced by pepsin digestion of the antibody molecule, and the Fab fragments, which can be generated by reducing the disulfide bridges of the F(ab').sub.2 fragments. Alternatively, Fab expression libraries may be constructed (Huse et al., Science 246:1275-1281, 1989) to allow rapid and easy identification of monoclonal Fab fragments with the desired specificity.

[0222]The protocols for detecting and measuring the expression of the described PC-1-L3 and/or PC-2-L1 and/or complexes herein, using the above mentioned antibodies, are well known in the art. Such methods include, but are not limited to, dot blotting, western blotting, competitive and noncompetitive protein binding assays, enzyme-linked immunosorbant assays (ELISA), immunohistochemistry, fluorescence-activated cell sorting (FACS), and others commonly used and widely described in scientific and patent literature, and many employed commercially.

[0223]One method, for ease of detection, is the sandwich ELISA, of which a number of variations exist, all of which are intended to be encompassed by the present invention. For example, in a typical forward assay, unlabeled antibody is immobilized on a solid substrate and the sample to be tested is brought into contact with the bound molecule and incubated for a period of time sufficient to allow formation of an antibody-antigen binary complex. At this point, a second antibody, labeled with a reporter molecule capable of inducing a detectable signal, is then added and incubated, allowing time sufficient for the formation of a ternary complex of antibody-antigen-labeled antibody. Any unreacted material is washed away, and the presence of the antigen is determined by observation of a signal, or may be quantitated by comparing with a control sample containing known amounts of antigen. Variations on the forward assay include the simultaneous assay, in which both sample and antibody are added simultaneously to the bound antibody, or a reverse assay, in which the labeled antibody and sample to be tested are first combined, incubated and added to the unlabeled surface bound antibody. These techniques are well known to those skilled in the art, and the possibility of minor variations will be readily apparent. As used herein, "sandwich assay" is intended to encompass all variations on the basic two-site technique. For the immunoassays of the present invention, the only limiting factor is that the labeled antibody be an antibody which is specific for the protein expressed by the gene of interest.

[0224]The most commonly used reporter molecules in this type of assay are either enzymes, fluorophore- or radionuclide-containing molecules. In the case of an enzyme immunoassay, an enzyme is conjugated to the second antibody, usually by means of glutaraldehyde or periodate. As will be readily recognized, however, a wide variety of different ligation techniques exist which are well-known to the skilled artisan. Commonly used enzymes include horseradish peroxidase, glucose oxidase, beta-galactosidase and alkaline phosphatase, among others. The substrates to be used with the specific enzymes are generally chosen for the production, upon hydrolysis by the corresponding enzyme, of a detectable color change. For example, p-nitrophenyl phosphate is suitable for use with alkaline phosphatase conjugates; for peroxidase conjugates, 1,2-phenylenediamine or toluidine are commonly used. It is also possible to employ fluorogenic substrates, which yield a fluorescent product, rather than the chromogenic substrates noted above. A solution containing the appropriate substrate is then added to the tertiary complex. The substrate reacts with the enzyme linked to the second antibody, giving a qualitative visual signal, which may be further quantitated, usually spectrophotometrically, to give an evaluation of the amount of PLAB which is present in the serum sample.

[0225]Alternately, fluorescent compounds, such as fluorescein and rhodamine, can be chemically coupled to antibodies without altering their binding capacity. When activated by illumination with light of a particular wavelength, the fluorochrome-labeled antibody absorbs the light energy, inducing a state of excitability in the molecule, followed by emission of the light at a characteristic longer wavelength. The emission appears as a characteristic color visually detectable with a light microscope. Immunofluorescence and EIA techniques are both very well established in the art and are particularly preferred for the present method. However, other reporter molecules, such as radioisotopes, chemiluminescent or bioluminescent molecules may also be employed. It will be readily apparent to the skilled artisan how to vary the procedure to suit the required use.

[0226]In one example, peptides for PKD2L1 and PKD1L3 were generated, and conjugated to carriers. Rabbits were immunized to make polyclonal antibodies. These antibodies were shown to bind PC-2-L1 and PC-1-L3 in situ (see also, Example 3, herein).

Regulating Gene Expression of PKD2L1/PKD1L3

[0227]Gene expression (e.g., transcription and/or translation) of PKD2L1 or PKD1L3 can be regulated using any of a variety of techniques known in the art. For example, gene expression can be inhibited using an antisense nucleic acid or an interfering RNA. Inhibition of expression in particular cell-types can be used for further studying the in vitro or in vivo role of these genes, and/or as a mechanism for treating a condition caused by overexpression of a PKD1L3 or PKD2L1 gene, and/or for treating a dominant effect caused by a particular allele of such a gene (polycystic kidney disease is caused by such dominant alleles in related PKD genes).

[0228]For example, use of antisense nucleic acids is well known in the art. An antisense nucleic acid has a region of complementarity to a target nucleic acid, e.g., a target gene, mRNA, or cDNA. Typically, a nucleic acid comprising a nucleotide sequence in a complementary, antisense orientation with respect to a coding (sense) sequence of an endogenous gene is introduced into a cell. The antisense nucleic acid can be RNA, DNA, a PNA or any other appropriate molecule. A duplex can form between the antisense sequence and its complementary sense sequence, resulting in inactivation of the gene. The antisense nucleic acid can inhibit gene expression by forming a duplex with an RNA transcribed from the gene, by forming a triplex with duplex DNA, etc. An antisense nucleic acid can be produced, e.g., for any gene whose coding sequence is known or can be determined by a number of well-established techniques (e.g., chemical synthesis of an antisense RNA or oligonucleotide (optionally including modified nucleotides and/or linkages that increase resistance to degradation or improve cellular uptake) or in vitro transcription). Antisense nucleic acids and their use are described, e.g., in U.S. Pat. No. 6,242,258 to Haselton and Alexander (Jun. 5, 2001) entitled "Methods for the selective regulation of DNA and RNA transcription and translation by photoactivation"; U.S. Pat. No. 6,500,615; U.S. Pat. No. 6,498,035; U.S. Pat. No. 6,395,544; U.S. Pat. No. 5,563,050; E. Schuch et al (1991) Symp Soc. Exp Biol 45:117-127; de Lange et al., (1995) Curr Top Microbiol Immunol 197:57-75; Hamilton et al., (1995) Curr Top Microbiol Immunol 197:77-89; Finnegan et al., (1996) Proc Natl Acad Sci USA 93:8449-8454; Uhlmann and A. Pepan (1990), Chem. Rev. 90:543; P. D. Cook (1991), Anti-Cancer Drug Design 6:585; J. Goodchild, Bioconjugate Chem. 1 (1990) 165; and, S. L. Beaucage and R. P. Iyer (1993), Tetrahedron 49:6123; and F. Eckstein, Ed. (1991), Oligonucleotides and Analogues--A Practical Approach, IRL Press.

[0229]Gene expression can also be inhibited by RNA silencing or interference. "RNA silencing" refers to any mechanism through which the presence of a single-stranded or, typically, a double-stranded RNA in a cell results in inhibition of expression of a target gene comprising a sequence identical or nearly identical to that of the RNA, including, but not limited to, RNA interference, repression of translation of a target mRNA transcribed from the target gene without alteration of the mRNA's stability, and transcriptional silencing (e.g., histone acetylation and heterochromatin formation leading to inhibition of transcription of the target mRNA).

[0230]The term "RNA interference" ("RNAi," sometimes called RNA-mediated interference, post-transcriptional gene silencing, or quelling) refers to a phenomenon in which the presence of RNA, typically double-stranded RNA, in a cell results in inhibition of expression of a gene comprising a sequence identical, or nearly identical, to that of the double-stranded RNA. The double-stranded RNA responsible for inducing RNAi is called an "interfering RNA." Expression of the gene is inhibited by the mechanism of RNAi as described below, in which the presence of the interfering RNA results in degradation of mRNA transcribed from the gene and thus in decreased levels of the mRNA and any encoded protein.

[0231]The mechanism of RNAi has been and is being extensively investigated in a number of eukaryotic organisms and cell types. See, for example, the following reviews: McManus and Sharp (2002) "Gene silencing in mammals by small interfering RNAs" Nature Reviews Genetics 3:737-747; Hutvagner and Zamore (2002) "RNAi: Nature abhors a double strand" Curr Opin Genet & Dev 200:225-232; Hannon (2002) "RNA interference" Nature 418:244-251; Agami (2002) "RNAi and related mechanisms and their potential use for therapy" Curr Opin Chem Biol 6:829-834; Tuschl and Borkhardt (2002) "Small interfering RNAs: A revolutionary tool for the analysis of gene function and gene therapy" Molecular Interventions 2:158-167; Nishikura (2001) "A short primer on RNAi: RNA-directed RNA polymerase acts as a key catalyst" Cell 107:415-418; and Zamore (2001) "RNA interference: Listening to the sound of silence" Nature Structural Biology 8:746-750. RNAi is also described in the patent literature; see, e.g., CA 2359180 by Kreutzer and Limmer entitled "Method and medicament for inhibiting the expression of a given gene"; WO 01/68836 by Beach et al. entitled "Methods and compositions for RNA interference"; WO 01/70949 by Graham et al. entitled "Genetic silencing"; and WO 01/75164 by Tuschl et al. entitled "RNA sequence-specific mediators of RNA interference."

[0232]In brief, double-stranded RNA introduced into a cell (e.g., into the cytoplasm) is processed, for example by an RNAse III-like enzyme called Dicer, into shorter double-stranded fragments called small interfering RNAs (siRNAs, also called short interfering RNAs). The length and nature of the siRNAs produced is dependent on the species of the cell, although typically siRNAs are 21-25 nucleotides long (e.g., an siRNA may have a 19 base pair duplex portion with two nucleotide 3' overhangs at each end). Similar siRNAs can be produced in vitro (e.g., by chemical synthesis or in vitro transcription) and introduced into the cell to induce RNAi. The siRNA becomes associated with an RNA-induced silencing complex (RISC). Separation of the sense and antisense strands of the siRNA, and interaction of the siRNA antisense strand with its target mRNA through complementary base-pairing interactions, optionally occurs. Finally, the mRNA is cleaved and degraded.

[0233]Expression of a target gene in a cell can thus be specifically inhibited by introducing an appropriately chosen double-stranded RNA into the cell. Guidelines for design of suitable interfering RNAs are known to those of skill in the art. For example, interfering RNAs are typically designed against exon sequences, rather than introns or untranslated regions. Characteristics of high efficiency interfering RNAs may vary by cell type. For example, although siRNAs may require 3' overhangs and 5' phosphates for most efficient induction of RNAi in Drosophila cells, in mammalian cells blunt ended siRNAs and/or RNAs lacking 5' phosphates can induce RNAi as effectively as siRNAs with 3' overhangs and/or 5' phosphates (see, e.g., Czaudema et al. (2003) "Structural variations and stabilizing modifications of synthetic siRNAs in mammalian cells" Nucl Acids Res 31:2705-2716). As another example, since double-stranded RNAs greater than 30-80 base pairs long activate the antiviral interferon response in mammalian cells and result in non-specific silencing, interfering RNAs for use in mammalian cells are typically less than 30 base pairs (for example, Caplen et al. (2001) "Specific inhibition of gene expression by small double-stranded RNAs in invertebrate and vertebrate systems" Proc. Natl. Acad. Sci. USA 98:9742-9747, Elbashir et al. (2001) "Duplexes of 21-nucleotide RNAs mediate RNA interference in cultured mammalian cells" Nature 411:494-498 and Elbashir et al. (2002) "Analysis of gene function in somatic mammalian cells using small interfering RNAs" Methods 26:199-213 describe the use of 21 nucleotide siRNAs to specifically inhibit gene expression in mammalian cell lines, and Kim et al. (2005) "Synthetic dsRNA Dicer substrates enhance RNAi potency and efficacy" Nature Biotechnology 23:222-226 describes use of 25-30 nucleotide duplexes). The sense and antisense strands of a siRNA are typically, but not necessarily, completely complementary to each other over the double-stranded region of the siRNA (excluding any overhangs). The antisense strand is typically completely complementary to the target mRNA over the same region, although some nucleotide substitutions can be tolerated (e.g., a one or two nucleotide mismatch between the antisense strand and the mRNA can still result in RNAi, although at reduced efficiency). The ends of the double-stranded region are typically more tolerant to substitution than the middle; for example, as little as 15 bp (base pairs) of complementarity between the antisense strand and the target mRNA in the context of a 21 mer with a 19 bp double-stranded region has been shown to result in a functional siRNA (see, e.g., Czauderna et al. (2003) "Structural variations and stabilizing modifications of synthetic siRNAs in mammalian cells" Nucl Acids Res 31:2705-2716). Any overhangs can but need not be complementary to the target mRNA; for example, TT (two 2'-deoxythymidines) overhangs are frequently used to reduce synthesis costs.

[0234]Although double-stranded RNAs (e.g., double-stranded siRNAs) were initially thought to be required to initiate RNAi, several recent reports indicate that the antisense strand of such siRNAs is sufficient to initiate RNAi. Single-stranded antisense siRNAs can initiate RNAi through the same pathway as double-stranded siRNAs (as evidenced, for example, by the appearance of specific mRNA endonucleolytic cleavage fragments). As for double-stranded interfering RNAs, characteristics of high-efficiency single-stranded siRNAs may vary by cell type (e.g., a 5' phosphate may be required on the antisense strand for efficient induction of RNAi in some cell types, while a free 5' hydroxyl is sufficient in other cell types capable of phosphorylating the hydroxyl). See, e.g., Martinez et al. (2002) "Single-stranded antisense siRNAs guide target RNA cleavage in RNAi" Cell 110:563-574; Amarzguioui et al. (2003) "Tolerance for mutations and chemical modifications in a siRNA" Nucl. Acids Res. 31:589-595; Holen et al. (2003) "Similar behavior of single-strand and double-strand siRNAs suggests that they act through a common RNAi pathway" Nucl. Acids Res. 31:2401-2407; and Schwarz et al. (2002) Mol. Cell. 10:537-548.

[0235]Due to currently unexplained differences in efficiency between siRNAs corresponding to different regions of a given target mRNA, several siRNAs are typically designed and tested against the target mRNA to determine which siRNA is most effective. Interfering RNAs can also be produced as small hairpin RNAs (shRNAs, also called short hairpin RNAs), which are processed in the cell into siRNA-like molecules that initiate RNAi (see, e.g., Siolas et al. (2005) "Synthetic shRNAs as potent RNAi triggers" Nature Biotechnology 23:227-231).

[0236]The presence of RNA, particularly double-stranded RNA, in a cell can result in inhibition of expression of a gene comprising a sequence identical or nearly identical to that of the RNA through mechanisms other than RNAi. For example, double-stranded RNAs that are partially complementary to a target mRNA can repress translation of the mRNA without affecting its stability. As another example, double-stranded RNAs can induce histone methylation and heterochromatin formation, leading to transcriptional silencing of a gene comprising a sequence identical or nearly identical to that of the RNA (see, e.g., Schramke and Allshire (2003) "Hairpin RNAs and retrotransposon LTRs effect RNAi and chromatin-based gene silencing" Science 301:1069-1074; Kawasaki and Taira (2004) "Induction of DNA methylation and gene silencing by short interfering RNAs in human cells" Nature 431:211-217; and Morris et al. (2004) "Small interfering RNA-induced transcriptional gene silencing in human cells" Science 305:1289-1292).

[0237]Short RNAs called microRNAs (miRNAs) have been identified in a variety of species. Typically, these endogenous RNAs are each transcribed as a long RNA and then processed to a pre-miRNA of approximately 60-75 nucleotides that forms an imperfect hairpin (stem-loop) structure. The pre-miRNA is typically then cleaved, e.g., by Dicer, to form the mature miRNA. Mature miRNAs are typically approximately 21-25 nucleotides in length, but can vary, e.g., from about 14 to about 25 or more nucleotides. Some, though not all, miRNAs have been shown to inhibit translation of mRNAs bearing partially complementary sequences. Such miRNAs contain one or more internal mismatches to the corresponding mRNA that are predicted to result in a bulge in the center of the duplex formed by the binding of the miRNA antisense strand to the mRNA. The miRNA typically forms approximately 14-17 Watson-Crick base pairs with the mRNA; additional wobble base pairs can also be formed. In addition, short synthetic double-stranded RNAs (e.g., similar to siRNAs) containing central mismatches to the corresponding mRNA have been shown to repress translation (but not initiate degradation) of the mRNA. See, for example, Zeng et al. (2003) "MicroRNAs and small interfering RNAs can inhibit mRNA expression by similar mechanisms" Proc. Natl. Acad. Sci. USA 100:9779-9784; Doench et al. (2003) "siRNAs can function as miRNAs" Genes & Dev. 17:438-442; Bartel and Bartel (2003) "MicroRNAs: At the root of plant development?" Plant Physiology 132:709-717; Schwarz and Zamore (2002) "Why do miRNAs live in the miRNP?" Genes & Dev. 16:1025-1031; Tang et al. (2003) "A biochemical framework for RNA silencing in plants" Genes & Dev. 17:49-63; Meister et al. (2004) "Sequence-specific inhibition of microRNA- and siRNA-induced RNA silencing" RNA 10:544-550; Nelson et al. (2003) "The microRNA world: Small is mighty" Trends Biochem. Sci. 28:534-540; Scacheri et al. (2004) "Short interfering RNAs can induce unexpected and divergent changes in the levels of untargeted proteins in mammalian cells" Proc. Natl. Acad. Sci. USA 101:1892-1897; Sempere et al. (2004) "Expression profiling of mammalian microRNAs uncovers a subset of brain-expressed microRNAs with possible roles in murine and human neuronal differentiation" Genome Biology 5:R13; Dykxhoorn et al. (2003) "Killing the messenger: Short RNAs that silence gene expression" Nature Reviews Molec. and Cell Biol. 4:457-467; McManus (2003) "MicroRNAs and cancer" Semin Cancer Biol. 13:253-288; and Stark et al. (2003) "Identification of Drosophila microRNA targets" PLoS Biol. 1:E60.

[0238]The cellular machinery involved in translational repression of mRNAs by partially complementary RNAs (e.g., certain mRAs) appears to partially overlap that involved in RNAi, although, as noted, translation of the mRNAs, not their stability, is affected and the mRNAs are typically not degraded.

[0239]The location and/or size of the bulge(s) formed when the antisense strand of the RNA binds the mRNA can affect the ability of the RNA to repress translation of the mRNA. Similarly, location and/or size of any bulges within the RNA itself can also affect efficiency of translational repression. See, e.g., the references above. Typically, translational repression is most effective when the antisense strand of the RNA is complementary to the 3' untranslated region (3' UTR) of the mRNA. Multiple repeats, e.g., tandem repeats, of the sequence complementary to the antisense strand of the RNA can also provide more effective translational repression; for example, some mRNAs that are translationally repressed by endogenous miRNAs contain 7-8 repeats of the miRNA binding sequence at their 3' UTRs. It is worth noting that translational repression appears to be more dependent on concentration of the RNA than RNA interference does; translational repression is thought to involve binding of a single mRNA by each repressing RNA, while RNAi is thought to involve cleavage of multiple copies of the mRNA by a single siRNA-RISC complex.

[0240]Guidance for design of a suitable RNA to repress translation of a given target mRNA can be found in the literature (e.g., the references above and Doench and Sharp (2004) "Specificity of microRNA target selection in translational repression" Genes & Dev. 18:504-511; Rehmsmeier et al. (2004) "Fast and effective prediction of microRNA/target duplexes" RNA 10:1507-1517; Robins et al. (2005) "Incorporating structure to predict microRNA targets" Proc Natl Acad Sci 102:4006-4009; and Mattick and Makunin (2005) "Small regulatory RNAs in mammals" Hum. Mol. Genet. 14:R121-R132, among many others) and herein. However, due to differences in efficiency of translational repression between RNAs of different structure (e.g., bulge size, sequence, and/or location) and RNAs corresponding to different regions of the target mRNA, several RNAs are optionally designed and tested against the target mRNA to determine which is most effective at repressing translation of the target mRNA.

Further Details Regarding Polycystin Variants

[0241]Any of a variety of PC-1-L3 and/or PC-2-L1 polypeptides and/or coding PKD1L3 and/or PKD2L1 nucleic acids can be used in the present invention. These include human PC-1-L3 and/or PC-2-L1 taste receptor polypeptides and/or coding PKD1L3 and PKD2L1 genes, murine PC-1-L3 and/or PC-2-L1 taste receptor polypeptides and/or coding PKD1L3 and PKD2L1 genes, and homologous polypeptides and coding nucleic acids from a domesticated or livestock animal. Examples of such polypeptides and coding PKD2L1 genes are available, including PC-2-L1 and PKD2L1 for mice, humans and dogs. Examples of such sequences are provided in the Examples below and are further available in public databases. In addition, naturally occurring homologues of these genes can readily be obtained simply by screening genomic or cDNA libraries for other organisms. These libraries are widely available, and can also be made using standard techniques, e.g., as taught in Sambrook or Ausubel.

[0242]The sequence of any PKD1L3 and/or PKD2L1 gene and coded polypeptide can also be modified by standard methods to provide variants of such available sequences, including conservative or non-conservative variants. Any available mutagenesis procedure can be used to modify a PKD1L3 or PKD2L1 gene. Such mutagenesis procedures optionally include selection of mutant nucleic acids and polypeptides for one or more activity of interest (e.g., increased responsiveness to tastant stimuli, which can be useful in producing transgenic animals, or for biosensor applications). Procedures that can be used include, but are not limited to: site-directed point mutatgenesis, random point mutagenesis, in vitro or in vivo homologous recombination (DNA shuffling), mutagenesis using uracil containing templates, oligonucleotide-directed mutagenesis, phosphorothioate-modified DNA mutagenesis, mutagenesis using gapped duplex DNA, point mismatch repair, mutagenesis using repair-deficient host strains, restriction-selection and restriction-purification, deletion mutagenesis, mutagenesis by total gene synthesis, double-strand break repair, and many others known to persons of skill. Mutagenesis, e.g., involving chimeric constructs, are also included in the present invention. In one embodiment, mutagenesis can be guided by known information of the naturally occurring molecule or altered or mutated naturally occurring molecule, e.g., sequence, sequence comparisons, physical properties, crystal structure or the like. In another class of embodiments, modification is essentially random (e.g., as in classical DNA shuffling).

[0243]Additional information regarding mutation is found in the following publications and references cited within: Arnold, Protein engineering for unusual environments, Current Opinion in Biotechnology 4:450-455 (1993); Bass et al., Mutant Trp repressors with new DNA-binding specificities, Science 242:240-245 (1988); Botstein & Shortle, Strategies and applications of in vitro mutagenesis, Science 229:1193-1201 (1985); Carter et al., Improved oligonucleotide site-directed mutagenesis using M13 vectors, Nucl. Acids Res. 13: 4431-4443 (1985); Carter, Site-directed mutagenesis, Biochem. J. 237:1-7 (1986); Carter, Improved oligonucleotide-directed mutagenesis using M13 vectors, Methods in Enzymol. 154: 382-403 (1987); Dale et al., Oligonucleotide-directed random mutagenesis using the phosphorothioate method, Methods Mol. Biol. 57:369-374 (1996); Eghtedarzadeh & Henikoff, Use of oligonucleotides to generate large deletions, Nucl. Acids Res. 14: 5115 (1986); Fritz et al., Oligonucleotide-directed construction of mutations: a gapped duplex DNA procedure without enzymatic reactions in vitro, Nucl. Acids Res. 16: 6987-6999 (1988); Grundstrom et al., Oligonucleotide-directed mutagenesis by microscale `shot-gun` gene synthesis, Nucl. Acids Res. 13: 3305-3316 (1985); Kunkel, The efficiency of oligonucleotide directed mutagenesis, in Nucleic Acids & Molecular Biology (Eckstein, F. and Lilley, D. M. J. eds., Springer Verlag, Berlin)) (1987); Kunkel, Rapid and efficient site-specific mutagenesis without phenotypic selection, Proc. Natl. Acad. Sci. USA 82:488-492 (1985); Kunkel et al., Rapid and efficient site-specific mutagenesis without phenotypic selection, Methods in Enzymol. 154, 367-382 (1987); Kramer et al., The gapped duplex DNA approach to oligonucleotide-directed mutation construction, Nucl. Acids Res. 12: 9441-9456 (1984); Kramer & Fritz Oligonucleotide-directed construction of mutations via gapped duplex DNA, Methods in Enzymol. 154:350-367 (1987); Kramer et al., Point Mismatch Repair, Cell 38:879-887 (1984); Kramer et al., Improved enzymatic in vitro reactions in the gapped duplex DNA approach to oligonucleotide-directed construction of mutations, Nucl. Acids Res. 16: 7207 (1988); Ling et al., Approaches to DNA mutagenesis: an overview, Anal Biochem. 254(2): 157-178 (1997); Lorimer and Pastan Nucleic Acids Res. 23, 3067-8 (1995); Mandecki, Oligonucleotide-directed double-strand break repair in plasmids of Escherichia coli: a method for site-specific mutagenesis, Proc. Natl. Acad. Sci. USA, 83:7177-7181 (1986); Nakamaye & Eckstein, Inhibition of restriction endonuclease Nci I cleavage by phosphorothioate groups and its application to oligonucleotide-directed mutagenesis, Nucl. Acids Res. 14: 9679-9698 (1986); Nambiar et al., Total synthesis and cloning of a gene coding for the ribonuclease S protein, Science 223: 1299-1301 (1984); Sakamar and Khorana, Total synthesis and expression of a gene for the a-subunit of bovine rod outer segment guanine nucleotide-binding protein (transducin), Nucl. Acids Res. 14: 6361-6372 (1988); Sayers et al., Y-T Exonucleases in phosphorothioate-based oligonucleotide-directed mutagenesis, Nucl. Acids Res. 16:791-802 (1988); Sayers et al., Strand specific cleavage of phosphorothioate-containing DNA by reaction with restriction endonucleases in the presence of ethidium bromide, (1988) Nucl. Acids Res. 16: 803-814; Sieber, et al., Nature Biotechnology, 19:456-460 (2001); Smith, In vitro mutagenesis, Ann. Rev. Genet. 19:423-462 (1985); Methods in Enzymol. 100: 468-500 (1983); Methods in Enzymol. 154: 329-350 (1987); Stemmer, Nature 370, 389-91 (1994); Taylor et al., The use of phosphorothioate-modified DNA in restriction enzyme reactions to prepare nicked DNA, Nucl. Acids Res. 13: 8749-8764 (1985); Taylor et al., The rapid generation of oligonucleotide-directed mutations at high frequency using phosphorothioate-modified DNA, Nucl. Acids Res. 13: 8765-8787 (1985); Wells et al., Importance of hydrogen-bond formation in stabilizing the transition state of subtilisin, Phil. Trans. R. Soc. Lond. A 317: 415-423 (1986); Wells et al., Cassette mutagenesis: an efficient method for generation of multiple mutations at defined sites, Gene 34:315-323 (1985); Zoller & Smith, Oligonucleotide-directed mutagenesis using M13-derived vectors: an efficient and general procedure for the production of point mutations in any DNA fragment, Nucleic Acids Res. 10:6487-6500 (1982); Zoller & Smith, Oligonucleotide-directed mutagenesis of DNA fragments cloned into M13 vectors, Methods in Enzymol. 100:468-500 (1983); and Zoller & Smith, Oligonucleotide-directed mutagenesis: a simple method using two oligonucleotide primers and a single-stranded DNA template, Methods in Enzymol. 154:329-350 (1987). Additional details on many of the above methods can be found in Methods in Enzymology Volume 154, which also describes useful controls for trouble-shooting problems with various mutagenesis methods.

Kits

[0244]In an additional aspect, the present invention provides kits embodying the methods, composition, systems or apparatus herein. Kits of the invention optionally comprise one or more of the following: (1) a composition, system, system component as described herein; (2) instructions for practicing the methods described herein, and/or for using the compositions or operating the system or system components herein; (3) one or more PC-1-L3 or PC-2-L1 polypeptide or complex or coding nucleic acid; (4) a container for holding components or compositions, and, (5) packaging materials.

EXAMPLES

[0245]The following Examples serve to illustrate, but not to limit the invention. One of skill will recognize a variety of non-critical parameters that can be changed to achieve essentially similar results.

Example 1

A Novel Ion Channel Preferentially Expressed in Mammalian Taste Receptor Cells (PC-2-L1/PKD2L1)

[0246]Introduction

[0247]Taste transduction is one of the most sophisticated forms of chemotransduction in animals (Avenet & Lindemann (1989) Perspectives in taste reception. 112, 1-8; Margolskee (1993) R. Bioessays 15, 645-650). Gustatory signaling is found throughout the animal kingdom, from simple metazoans to the most complex of vertebrates; its main purpose is to provide a reliable signaling response to non-volatile ligands. Mammals are believed to have five basic types of taste modalities: salty, sour, sweet, umami (the taste of MSG), and bitter. Each of these is thought to be mediated by distinct signaling pathways leading to receptor cell depolarization, generation of a receptor or action potential, and release of neurotransmitter and synaptic activity (Roper (1989) Ann. Rev. Neurosci. 12:329-353). Recently, the receptors for bitter, sweet and umami were cloned and shown to be encoded by two families of G-protein coupled receptors (Nelson et al. (2001) "Mammalian sweet taste receptors" Cell 106(3): 381-90; Nelson et al. (2002) "An amino-acid taste receptor" Nature 416(6877): 199-202; Zhang et al. (2003) "Coding of sweet, bitter, and umami tastes: different receptor cells sharing similar signaling pathways" Cell; 112(3):293-301; Zhao et al. (2003) "The receptors for mammalian sweet and umami taste" Cell 115(3):255-66; Mueller et al. (2005) "The receptors and coding logic for bitter taste" Nature 434 (7030): 225-9. In contrast, most of the molecular components of sour or salty pathways remain unknown. Electrophysiological studies suggest that sour and salty tastants modulate taste cell function by direct entry of H+ and Na+ ions through specialized membrane channels on the apical surface of the cell. Thus, ion channels selectively expressed in taste receptor cells are ideal candidates as mediators of salt and sour tastes. Alternatively, ion channels may function as the final critical signaling component in the activation of taste cells (alcin to the role of TRPM5 in sweet, umami and bitter cells; Zhang et al. (2003) "Coding of sweet, bitter, and umami tastes: different receptor cells sharing similar signaling pathways" Cell 112(3):293-30).

[0248]The identification and isolation of taste signaling molecules, in particular receptors, ion channels and signaling components, would allow for pharmacological and genetic modulation of taste signaling pathways. For example, availability of receptor and channel molecules (which are accessible from outside of the cell) would permit the screening for high affinity agonists, antagonists, inverse agonists, and enhancers of taste cell activity. These could then be used in the pharmaceutical and food industry to custom tune, enhance, block, or modulate different tastes. In addition, these cDNAs serve as invaluable tools in the generation of taste (tongue-brain) topographic maps of sensory coding, and the dissection of taste-induced behaviors. Here we report the cloning and characterization of a taste-specific ion channel.

[0249]Overview

[0250]To discover novel receptors, ion channels and other membrane signaling molecules involved in signal transduction in taste receptor cells, we developed a novel bioinformatics/molecular screening strategy. Our approach relied on two empirical assumptions: First, receptors and ion channels are transmembrane proteins. Second, sensory receptors in the visual, olfactory, touch and taste systems are often selectively expressed in restricted numbers of tissues. Therefore, we searched the mouse genome for transmembrane proteins, and then screened for those with restricted expression. Chosen molecules were subjected to experimental validation by PCR amplification reactions using taste tissue and in situ hybridization studies against mouse tongues.

[0251]Using a Hidden Markov Model (TMHMM 2.0) and f_TMHMM (UCSD Supercomputing Center, Bourne lab), we screened the entire Ensembl mouse genome database for genes encoding putative transmembrane domains. In order to determine the tissue distribution for the chosen candidate genes, we used mouse Expression Sequence Tag (EST) databases (www.ncbi.nlm.nih.gov/BLAST) to identify gene transcripts (i.e., cDNAs) expressed in 3 tissues/organs or less. PCR amplification primers were then prepared against selected cDNAs and RT-PCR reactions using mRNA from taste and non-taste tissues were carried out. Candidates preferentially expressed in taste receptor cells were used for RNA in situ hybridization against various taste papillae. This strategy led to the isolation of a novel taste-specific ion channel.

[0252]Bioinformatics Screen

[0253]Using a Hidden Markov Model (TMHMM 2.0) and f_TMHMM (UCSD Supercomputing Center, Bourne lab) we screened the entire Ensembl mouse genome database for genes encoding transmembrane domains. In order to determine the tissue distribution for candidate cDNAs encoding transmembrane proteins, we used mouse Expression Sequence Tag (EST) databases as an expression filter (www.ncbi.nlm.nih.gov/BLAST); each cDNA expressed in 3 tissues/organs or less, was chosen for further study.

[0254]Summary of results: (1) We identified 13,742 predicted and annotated transcripts encoding candidate transmembrane domains (Ensembl version mm.30). (2) 1077 genes were selected by EST analyses as being expressed in 3 tissues or less. (3) 884 genes were chosen and subjected to taste versus non-taste RT-PCR reactions using primers against the last exon and/or the 3' untranslated region (primers were designed using http://frodo.wi.mit.edu/cgi-bin/primer3/primer3_www.cgi). (4) 26 candidates were chosen for detailed in situ analysis.

[0255]Tissue Collection & RT-PCR Screen:

[0256]In order to determine if candidate cDNAs were selectively expressed in taste receptor cells--a goal of this example--we performed RT-PCR reactions using mRNA from taste and non-taste tissue.

[0257]Peeled, hand-dissected circumvallate and foliate taste papillae from .about.20 mice were collected for each mRNA extraction (total of .about.120 mice were used). Tissue was stored in RNAlater (Qiagen), and mRNA was extracted using Micro-FastTrack 2.0 mRNA extraction kit (Invitrogen). cDNA was synthesized using SuperScript II first-strand cDNA synthesis kit (Invitrogen) using oligo(dT) as primers. cDNA synthesis and progress was monitored by using T1R3 (Nelson et al., 2001) and GAPDH as controls.

[0258]RT-PQR experiments were performed using a minimum of two independent RT preparations, each containing a mix of circumvallate and folliate mRNA (taste mRNA). As counter-screen, we sampled each candidate cDNA in two independent RT reactions using tongue epithelium devoid of taste receptor cells (non-taste mRNA). 98 of the 884 candidates showed specific RT-PCR reaction products in taste samples but not in any of the non-taste reactions.

[0259]Data-Mining & RNA In Situ Hybridization:

[0260]Candidates shown to be selectively enriched in taste tissue by RT-PCR were examined in detail using BLAST (http://www.ncbi.nlm.nih.gov/BLAST/) and motif search engines, and subjected to RNA in situ hybridizations experiments (see methods section in Hoon et al. (1999) "Putative mammalian taste receptors: a class of taste-specific GPCRs with distinct topographic selectivity" Cell 96:541-51 for details on in situ preparations). Male and female mouse tongues containing different taste papillae were used in all in situ studies. Clone ID 529-30/597-8 was shown to be expressed in selective subsets of taste receptor cells. FIG. 1 shows results from the RNA in situ hybridization in circumvallate taste papillae. Note the expression in subsets of taste cells, but not in surrounding non-taste tissue.

[0261]Clone ID529-30/597-8:

[0262]This gene was (a) isolated as one of the candidates of the bioinformatics screen, (b) found to be enriched in taste papillae using our RT-PCR screen, and (c) shown to be expressed in a selective subset of taste receptor cells.

[0263]Analyses of mouse, rat, and human sequence databases showed that the clone defined by PCR primers "CloneID529-30/597-8" encodes PKD2L1, a distant member of the Polycystin Kidney Disease family of proteins (Nomura, et al. (1998) "Identification of PKDL, a novel polycystic kidney disease 2-like gene whose murine homologue is deleted in mice with kidney and retinal defects" J. Biol. Chem. 273:25967-25973), referred to as the TRPP family (Lin and Corey (2005) "TRP channels in mechanosensation" Curr Opin Neurobiol. 15(3):350-7. Review). PKD2L1 is most similar to PKD2. The human gene was first identified by Wu et al. (Wu et al. (1998) "Identification of PKD2L, a Human PKD2-Related Gene: Tissue-specific Expression and Mapping to Chromosome 10q25" Genomics 54(3) 564-568), and the mouse ortholog was isolated in a search for new members of the PKD family (Basora et al. (2002) "Tissue and Cellular Localization of a Novel Polycystic Kidney Disease-Like Gene Product, Polycystin-L" J. Am. Soc. Nephrol 13:293-301). An alignment of sequences for human, rat, and mouse PKD2L1 is provided in FIG. 2A-2B. Included in the alignment in FIG. 2A is the match to a PCR fragment isolated from taste receptor cells (corresponding to exons 2-5), and used as the probe in the in situ studies shown in FIG. 1A. FIG. 2B shows an alignment of mouse to rat and human, along with percent identity calculations between mouse and rat (.about.86% identical) and mouse and human (.about.80% identical).

TABLE-US-00003 Mouse PKD2L1 fragment isolated from taste tissue (exons 2-5) (SEQ ID NO: 1): DNA ACAGCCGAGAACAGGGAGCTTTATGTCAAGACCACCCTG AGGGAGCTTGTGGTATACATAGTGTTCCTCGTGGACGTCTGTCTGTTGAC CTACGGAATGACAAGTTCTAGTGCCTATTACTACACCAAAGTGATGTGTG AGTTGTTCCTACACACCCCATCCGACTCTGGAGTCTCCTTCCAGACCATC AGCAGCATGTCAGACTTCTGGGATTTTGCTCAGGGCCCACTCCTGGAGAG TTTGTACTGGACAAAGTGGTACAACAACCAGAGCCTGGGGCGTGGCTCCC ACTCCTTCATCTACTATGAGAACCTGCTCCTGGGAGCCCCAAGGTTGCGG CAGCTGCGCGTGCGCAATGACTCCTGTGTGGTTCATGAAGACTTCCGGGA GGACATTTTGAACTGTTATGATGTGTACTCGCCGGACAAAGAAGATCAGC TCCCCTTTGGACCTCTGAACGGCACAGCGTGGACATACCATTCCCAGAAT GAGCTGGGTGGCTCCTCCCACTGGGGCAGGCTCACAAGCTACAGCGGGGG TGGCTACTACTTGGATCTTCCAGGATCCCGACAAGCCAGTGCAGAGGCCC TCCAAGGACTCCAGGAGGGACTG

[0264]Taste tissue may also express PKD2L1 splice variants and may be present in PKD2L1 cDNA libraries.

TABLE-US-00004 Predicted Amino Acid sequence (SEQ ID NO: 2) TAENRELYVKTTLRELVVYIVFLVDVCLLTYGMTSSSAYYYTKVMS ELFLHTPSDSGVSFQTISSMSDFWDFAQGPLLDSLYWTKWYNNQSLGRGSHSFIYY ENLLLGAPRLRQLRVRNDSCVVHEDFREDILNCYDVYSPDKEDQLPFGPLNGTAWT YHSQNELGGSSHWGRLTSYSGGGYYLDLPGSRQASAEALQGLQEGL mouse PKD2L1 predicted mRNA (full-length, SEQ ID NO: 3) ATGAAAGTATGGAAAGCCCCAAGAATCAGGAGCTACAAACCCTG GGGAACAGAGCCTGGGACAATCCTGCCTACAGCGACCCTCCTTCCCCGAACAG GACGCTGAGGATCTGCACTGTCTCCAGTGTGGCTCTCCCTGAGACTCAACCCAA AAAGCCAGAAGTCAGATGCCAGGAGAAGACACAGAGAACCCTGGTGTCCAGCT GCTGTCTCCATATCTGTCGGAGCATCAGAGGACTGTGGGGGACAACGCTGACTG AGAACACAGCCGAGAACAGGGAGCTTTATGTCAAGACCACCCTAAGGGAGCTT GTGGTATACATAGTGTTCCTCGTGGACGTCTGTCTGTTGACCTACGGAATGACA AGTTCTAGTGCCTATTACTACACCAAAGTGATGTCTGAATTGTTTCTACACACCC CATCCGACTCTGGAGTCTCCTTCCAAACCATCAGCAGCATGTCAGACTTCTGGG ATTTTGCTCAGGGCCCACTCCTGGACAGTTTGTACTGGACAAAGTGGTACAACA ACCAGAGCCTGGGGCGTGGCTCCCACTCCTTCATCTACTATGAGAACCTGCTCC TGGGAGCCCCAAGGTTGCGGCACGTGCGCGTGCGCAATGACTCCTGTGTGGTTC ATGAAGACTTCCGGGAGGACATTTTGAACTGTTATGATGTGTACTCGCCGGACA AAGAAGATCAGCTCCCCTTTGGACCTCAGAACGGCACAGCGTGGACATACCATT CCCAGAATGAGCTGGGTGGCTCCTCCCAGTGGGGCAGGCTCACAAGCTACAGC GGGGGTGGCTACTACTTGGATCTTCCAGGATCCCGACAAGCCAGTGCAGAGGC CCTCCAAGGACTCCAGGAGGGACTGTGGCTGGACAGGGGCACTCGGGTGGTCT TTATCGACTTCTCCGTCTACAATGCCAACATCAATCTTTTCTGTATTCTGAGACT GGTGGTAGAGTTTCCAGCCACAGGAGGGACCATCCCATCCTGGCAGATCCGCA CAGTTAAGCTGATCCGCTATGTGAATAACTGGGACTTCTTCATTGTGGGCTGTG AAGTTGTCTTCTGTGTCTTCATCTTCTATTATGTGGTGGAGGAAATCCTGGAAAT CCACCTGCATCGGCTTCGCTACCTCAGCAGCGTCTGGAACATTCTGGACCTGGT GGTCATCTTGCTCTCCATCGTGGCTGTGGGTTTCCACATATTCCGAACCCTGGAA GTGAACCGACTGATGGGAAAGCTTCTGCAACAGCCAGACACGTATGCAGACTT TGAGTTCCTGGCCTTCTGGCAGACTCAGGACAATAACATGAACGCGGTCAACCT TTTCTTTGCTTGGATCAAGATATTCAAGTATATCAGCTTCAACAAGACCATGAC ACAGCTCTCCTCCACCCTGGCTCGATGTGCCAAGGACATCCTGGGCTTCGCAGT CATGTTCTTCATTGTCTTCTTCGCTTACGCCCAGCTTGGTTACCTGCTTTTTGGGA CCCAAGTGGAAAACTTTAGCACTTTCGTCAAGTGCATTTTCACTCAGTTCCGGA TAATCCTTGGGGATTTTGACTACAATGCCATCGACAATGCCAACAGAATCCTGG GCCCTGTGTACTTTGTCACCTATGTCTTCTTCGTCTTCTTTCGTGCTCCTGAACATG TTCCTGGCCATCATCAACGACACATACTCCGAGGTCAAGGAGGAGCTGGCTGGC CAGAAGGATCAGTTGCAGCTTTCTGACTTCCTGAAACAGAGCTACAACAAGACC CTACTAAGGCTGCGCCTGAGGAAAGAGCGGGTTTCTGATGTGCAGAAGGTCCT GAAGGGTGGGGAACCAGAGATCCAGTTTGAAGATTTCACCAGCACCTTGAGGG AACTGGGGCACGAGGAGCACGAGATCACCGCTGCCTTCACCAGGTTTGATCAG GATGGGGACCACATACTGGATGAGGAGGAGCAGGAACAGATGCGGCAGGGAC TGGAAGAGGAGAGGGTGACCCTCAATGCTGAGATTGAGAACCTAGGCCGGTCT GTTGGACACAGCCCCCCAGGCGAATTGGGCGCGGAGGCTGCCAGAGGACAAAG CTGGGTTTCTGGAGAAGAATTCGACATGCTCACAAGGAGAGTTCTGCAGCTGCA GTGTGTTCTGGAAGGAGTTGTGTCCCAGATTGATGCTGTAGGCTCAAAGCTGAA GATGCTGGAGAGGAAAGGGGAGCTGGCTCCCTCCCCAGGAATGGGGGAACCAG CTGTTTGGGAGAACCTGTATAATCCGTCCTAGT human PKD2L1 taste predicted mRNA sequence (full-length, SEQ ID NO: 4): ATGAATGCTGTGGGAAGTCGTGAGGGGCAGGAGCTGCAAAAGCT GGGGAGTGGAGCCTGGGACAACCCCGCCTACAGTGGTCCCCCTTCCCCACACG GGACGCTGAGAGTCTGCACCATCTCCAGCACGGGGCCTCTCCAGCCCCAACCCA AGAAGCCTGAAGATGAACCCCAGGAGACGGCATACAGGACCCAGGTGTCCAGC TGCTGCCTCCATATCTGTCAAGGCATCAGAGGACTTTGGGGAACAACCCTGACT GAGAACACAGCTGAGAACCGGGAACTTTATATCAAGACCACCCTGAGGGAGCT GTTGGTATATATTGTGTTCCTGGTGGACATCTGTCTACTGACCTATGGAATGACA AGCTCCAGTGCTTATTACTACACCAAAGTGATGTGTGAGCTCTTCTTACATACTC CATCAGACACTGGAGTCTCCTTTCAGGCCATCAGCAGCATGGCGGACTTCTGGG ATTTTGCCCAGGGCCCACTACTGGACAGTTTGTATTGGACCAAATGGTACAACA ACCAGAGCCTGGGCCATGGCTCCCACTCCTTCATCTACTATGAGAACATGCTGC TGGGGGTTCCGAGGCTGCGGCAGCTAAAGGTCCGCAATGACTCCTGTGTGGTGC ATGAAGACTTCCGGGAGGACATTCTGAGCTGCTATGATGTCTACTCTCCAGACA AAGAAGAACAACTCCCCTTTGGGCCCTTCAATGGCACAGCGTGGACATACCACT CGCAGGATGAGTTGGGGGGCTTCTCCCACTGGGGCAGGCTCACAAGCTACAGC GGAGGTGGCTACTACCTGGACCTTCCAGGATCCCGACAGGGTAGTGCAGAGGC TCTCCGGGCCCTTCAGGAGGGGCTGTGGCTGGACAGGGGCACTCGAGTGGTGTT CATCGACTTCTCAGTCTACAATGCCAATATCAATCTTTTCTGTGTCCTGAGGCTG GTGGTGGAGTTTCCAGCTACAGGAGGTGCCATCCCATCCTGGCAAATCCGCACA GTCAAGCTGATCCGCTATGTCAGCAACTGGGACTTCTTTATCGTTGGCTGTGAG GTCATCTTCTGCGTCTTCATCTTCTACTATGTGGTGGAAGAGATCCTGGAGCTCC ACATTCACCGGCTTCGCTACCTCAGCAGCATCTGGAACATACTGGACCTGGTGG TCATCTTGCTCTCCATTGTGGCTGTGGGCTTCCACATATTCCGAACCCTCGAGGT GAATCGGCTCATGGGGAAGCTCCTGCAGCAGCCAAACACGTATGCAGACTTTG AGTTCCTCGCCTTCTGGCAGACACAGTACAACAACATGAATGCTGTCAACCTCT TCTTCGCCTGGATCAAGATATTCAAGTACATCAGCTTCAACAAAACCATGACCC AGCTCTCCTCCACGCTGGCCCGCTGTGCCAAGGACATCCTGGGCTTCGCCGTCA TGTTCTTCATTGTTTTCTTCGCCTATGCCCAACTCGGCTACCTGCTTTTCGGGACC CAAGTGGAAAACTTTAGCACTTTCATCAAGTGCATTTTCACTCAGTTCCGGATA ATCCTCGGGGACTTTGACTACAATGCTATCGACAATGCCAACCGCATCCTGGGC CCTGCCTACTTTGTCACCTATGTGTCTTCGTCTTCTTCGTGCTCCTGAACATGTT CCTGGCCATCATCAATGACACATATTCAGAGGTCAAGGAGGAGCTGGCTGGAC AGAAGGATGAGCTGCAACTTTCTGACCTCCTGAAACAGGGCTACAACAAGACC CTACTAAGACTGCGTCTGAGGAAGGAGAGGGTTTCGGATGTGCAGAAGGTCCT GCAGGGTGGGGAGCAGGAGATCCAGTTTGAGGATTTCACCAACACCTTAAGGG AACTGGGACACGCAGAGCATGAAATCACTGAGCTCACGGCCACCTTCACCAAG TTTGACAGAGATGGGAATCGTATTCTGGATGAGAAGGAACAGGAAAAAATGCG ACAGGACCTGGAGGAAGAGAGGGTGGCCCTCAACACTGAGATTGAGAAACTAG GCCGATCTATTGTGTAGCAGCCCACAAGGCAAATCGGGTCCAGAGGCTGCCAGA GCAGGAGGCTGGGTTTCAGGAGAAGAATTCTACATGCTCACAAGGAGAGTTCT GCAGCTGGAGACTGTCCTGGAAGGAGTAGTGTCCCAGATTGATGCTGTAGGCTC AAAGCTGAAAATGCTGGAGAGGAAGGGGTGGCTGGCTCCCTCCCCAGGCGTGA AGGAACAAGCTATTTGGAAGCACCCGCAGCCAGCCCCAGCTGTGACCCCAGAC CCCTGGGGAGTCCAGGGTGGGCAGGAGAGTGAGGTTCCCTATAAAAGAGAAGA GGAAGCCTTAGAGGAGAGGAGACTCTCCCGTGGTGAGATTCCAACGTTGCAGA GGAGTTAA Ensembl predicts an ortholog in the Dog genome: geneID<ENSCAFG00000009644> (SEQ ID NO: 5) MNAVESPEGQELQKMGSGAWDNPAYSGPPSPRGTLKICTISSAMPPQPQIQK PEDGPQEKAYRTLVSSCCFQICRGIRGLWGTTLTENTAENRELYVKTTLRELLVYIV FLVDICLLTYGMTSSSAYYYTKVMSELFLHTPSDTGVSFQAISSMADFWDFAQGPL LDSLYWTKWYNNQSLGHGSHSFIYYENLLLGVPRLRQLRVRNDSCVVHEDFREDIL SCYDVYSPDKEEQLPFGPLNGTAWTYHSQDELGGSSHWGRLTSYSGGGYYLDLPG SRQASAEALQDLQEGLWLDRGTRVVFIDFSVYNANINLFCVLRLVVEFPATGGAIPS WQIRTVKLIRYVSNWDFFIIGCEIIFCIFIVYYMVEEILELHIHRLHYLSSIWNILDLVV IMLSIVAVGFHIFRTLEVNRLMGKLLQQPNMYADFEFLAFWQTQYNNMNAVNLFF AWIKIFKYISFNKTMTQLSSTLARCAKDILGFAVMFFIVFFAYAQLGYLLFGTQVEN FSTFIKCIFTQFRIILGDFDYNAIDNANRLGPAYFVTYVFFVFFVLLNMFLAIINDTYS EVKEELAGQKDELQLSDLLKQGYNKTLLRLRLRKERVSDVQKVLQGGEQEIQFED FTNTLRELGHAEHEITELTAAFTRFDQDGNHILDKKEQEQMQQDLEEKRVVLNAEI ENLGQSIVSSSPGESGPEATRADGWVSGEEFYTLTRRVLQLETVLEGVMSQVDAVG SKLEMLERKEQLASSPGMGDQGIWEHLQPTSPVTPDPWGVQGGQESEFPGGREGE ALEEMRLS

[0265]Additional References

[0266]Liu et al. (2002) "Modulation of the human polycystin-L channel by voltage and divalent cations" FEBS Letters 525 (1-3) 71-76; Keller et al. (1994) "Kidney and Retinal Defects (Krd), a Transgene-Induced Mutation with a Deletion of Mouse Chromosome 19 That Includes the Pax2 Locus" Genomics 23: 309-320; Gilbertson, T. (1993) The physiology of vertebrate taste reception 3, 532-539; Kinnamon and Margolskee (1996), Curr. Opin. Neurobiol. 4:506-513; Adler et al. (2000) "A novel family of mammalian taste receptors" Cell 100:693-702; Chandrashekar et al. (2000) "T2Rs function as bitter taste receptors" Cell 100:703-711.

Example 2

A Novel Gene Preferentially Expressed in Mammalian Taste Receptor Cells (PKD1L3)

[0267]To discover novel receptors, ion channels and other membrane signaling molecules involved in signal transduction in taste receptor cells, we developed a novel bioinformatics/molecular screening strategy. Our approach relied on two empirical assumptions: First, receptors and ion channels are transmembrane proteins. Second, sensory receptors in the visual, olfactory, touch and taste systems are often selectively expressed in restricted numbers of tissues. Therefore, we searched the mouse genome for transmembrane proteins, and then screened for those with restricted expression. Chosen molecules were subjected to experimental validation by PCR amplification reactions using taste tissue and in situ hybridization studies against mouse tongues.

[0268]Overview

[0269]Using a Hidden Markov Model (TMHMM 2.0) and f_TMHMM (UCSD Supercomputing Center, Boume lab), we screened the entire Ensembl mouse genome database for genes encoding putative transmembrane domains. In order to determine the tissue distribution for the chosen candidate genes, we used mouse Expression Sequence Tag (EST) databases (www.ncbi.nlm.nih.gov/BLAST) to identify gene transcripts (i.e., cDNAs) expressed in 3 tissues/organs or less. PCR amplification primers were then prepared against selected cDNAs and RT-PCR reactions using mRNA from taste and non-taste tissues were carried out. Candidates preferentially expressed in taste receptor cells were used for RNA in situ hybridization against various taste papillae. Full-length clones were then isolated from cDNA libraries prepared from taste tissue and testis (testis usually express most sensory-specific genes). This strategy led to the isolation of a PKD2-L1 (PKD2-like 1), a member of the Polycystic Kidney Disease (PKD) family of proteins selectively expressed in taste tissue (See, Example 1).

[0270]Members of the PKD family of genes belong to one of two independent subgroups: PKD1s and PKD2s. Since PKD2s are often found in association with PKD1s (generally as heteromeric receptors/channels), we searched for PKD1-related family members in taste tissue. Using RT-PCR and RNA in situ hybridizations against taste papillae, we isolated and identified PKD1-L3 as a novel PKD selectively expressed in subsets of taste receptor cells.

[0271]Bioinformatics Screen:

[0272]Using homology and literature searches we screened the mouse and human genome databases for members of the PKD1 family of proteins. We then performed RT-PCR reactions with primers specifically targeting predicted exon regions for PKD1, PKD1-L1 (Yuasa et al., 2002), PKD1-L2 (Li et al., 2003), and PKD1-L3 (Li et al., 2003) using mRNA from taste tissue. Two sets of primers specific for PKD1-L3 produced correct PCR products in taste tissue but not in control non-taste epithelia.

[0273]RT-PCRs

[0274]Peeled, hand-dissected circumvallate and foliate taste papillae from .about.20 mice were collected for each mRNA extraction (total of .about.120 mice were used). Tissue was stored in RNAlater (Qiagen), and mRNA was extracted using Micro-FastTrack 2.0 mRNA extraction kit (Invitrogen). cDNA was synthesized using SuperScript II first-strand cDNA synthesis kit (Invitrogen) using oligo(dT) as primers. cDNA synthesis and progress was monitored by using T1R3 (Nelson et al., 2001) and GAPDH as controls.

[0275]RT-PCR experiments were performed using a minimum of two independent RT preparations, each containing a mix of circumvallate and folliate mRNA (taste mRNA).

[0276]RNA In Situ Hybridization:

[0277]Candidates shown to be selectively enriched in taste tissue by RT-PCR were cloned into plasmid vectors and used to generate specific probes for RNA in situ hybridizations experiments (see methods section in Hoon et al., 1999 for details on in situ preparations). Male and female mouse tongues containing different taste papillae were used in all in situ studies. FIG. 3 demonstrates that PKD1-L3 (probes ID "ex28-32" and "ex25" derived from exons 28-32 and exon 25, respectively) selectively labels taste receptor cells. Note the expression in subsets of taste cells, but not in surrounding non-taste tissue. FIG. 4 shows an alignment of mouse, rat, and human PKD1-L3 protein sequences, including computer-predicted exons.

REFERENCES

[0278]Hoon M A, Adler B, Lindemeier J, Battey J F, Ryba N J, Zuker C S (1999). Putative mammalian taste receptors: a class of taste-specific GPCRs with distinct topographic selectivity. Cell 96, 541-51 [0279]Nelson, G., Hoon, M A., Chandrashekar, J., Zhang, Y., Ryba, N J., and Zuker, C S. (2001). Mammalian sweet taste receptors. Cell. 2001 Aug. 10; 106(3): 381-90. [0280]Lin, S Y, and Corey, D P. (2005). TRP channels in mechanosensation. Curr Opin Neurobiol. 2005 May 25 (Epub ahead of print) Nomura, H., Turco, A E., Pei, Y., Kalaydjieva, L., Schiavello, T., Weremowicz, S., Ji, W., Morton, C., Meisler, M., Reeders, S T., and Zhou, J. (1998) Identification of PKDL, a novel polycystic kidney disease 2-like gene whose murine homologue is deleted in mice with kidney and retinal defects. J. Biol. Chem. 273 (1998), pp. 25967-25973. [0281]Wu, G., Hayashi, T., Park, J H., Dixit, M., Reynolds, D M., Li, L., Maeda, Y., Cai, Y., Coca-Prados, M., and Somlo, S. (1998) Identification of PKD2L, a Human PKD2-Related Gene: Tissue-specific Expression and Mapping to Chromosome 10q25. Genomics. vol 54(3) Dec. 15, 1998 pg. 564-568. [0282]Liu, Y., L1, Q., Tan, M., Zhang, Y Y., Karpinski, E., Zhou, J., and Chen, X Z. (2002). Modulation of the human polycystin-L channel by voltage and divalent cations. FEBS Letters Vol 525, Issues 1-3, Aug. 14, 2002, pages 71-76. [0283]Basora, N., Nomura, H., Berger, UV., Stayner, C., Guo L., Shen, X., and Zhou, J. (2002) Tissue and Cellular Localization of a Novel Polycystic Kidney Disease-Like Gene Product, Polycystin-L. J. Am. Soc. Nephrol 13:293-301, 2002. [0284]Li A, Tian X, Sung SW, and Somlo S. (2003) Identification of two novel polycystic kidney disease-1-like genes in human and mouse genomes. Genomics. 2003 June; 81(6): 596-608. Erratum in: Genomics. 2003 October; 82(4): 498-500. [0285]Yuasa T, Venugopal B, Weremowicz S, Morton CC, Guo L, and Zhou J. (2002) The sequence, expression, and chromosomal localization of a novel polycystic kidney disease 1-like gene, PKD1L1, in human. Genomics. 2002 March; 79(3):376-86.

TABLE-US-00005 [0285]Mouse PKD1-L3 gene fragments isolated from taste tissue cdna: PKD1L3 Exon25 (SEQ ID NO: 6): TCCACAAGCAAATGAAGTCGCCTCCCCAACATCAGGAGGACAGAGAGAACTAT GGGGCTGGCTGGGTCCCCCCTGACACAAACATCACAAAAGTAGACAGTATTTG GCATTATCAGAATCAGGAGTCGCTGGGAGGCTATCCCATCCAAGGGGAGCTAG CCACTTACTCAGGAGGAGGCTATGTTGTGAGGCTTGGAAGAAACCACAGGGCG PKD1-L3 Exons 28-32 (SEQ ID NO: 7): GGAAAAGGAACCTCCTGGACACAAGCATCGTCCTCATTAGCTTCAGCATCCTGG GCCTCAGCATGCAGAGCCTCTCTCTACTTCACAAAAAGATGCAGCAGTACCACT GTGACCGGGACAGGTTCATCAGTTTCTACGAGGCACTGAGAGTGAACTCTGCAG TCACCCACCTCAGGGGCTTCCTGCTTCTCTTCGCAACTGTGCGGGTCTGGGACCT ACTGCGACATCATGCCCAGTTACAGGTCATCAACAAGACACTGTCCAAAGCCTG GGACGAGGTGCTGGGCTTTATACTGATCATCGTGGTCCTGTTAAGCAGCTATGC CATGACTTTCAACCTGCTGTTTGGATGGAGCATCTCTGACTACCAGAGCTTCTTC AGATCTATAGTGACTGTTGTTGGCCTCTTGATGGGAACTTCAAAGCACAAGGAG GTTATTGCTCTATACCCAATCCTGGGCTCCCTTTTGGTTCTCAGTAGCATCATCT TGATGGGACTTGTGATCATTAATCTTTTTGTTTCTGCCATTCTCATTGCCTTTGGG AAAGAAAGGAAGGCCTGTGAGAAAGAAGCTACACTGACAGATATGTTACTACA AAAGCTCTCAAGTCTGTTAGGAATCCGCCTGCACCAGAATCCATCTGAGGAACA CGC Predicted Amino Acid sequences: PKD1L3 Exon 25 (SEQ ID NO: 8) HKQMKSPPQHQEDRENYGAGWVPPDTNITKVDSIWHYQNQESLGGYPIQG ELATYSGGGYVVRLGRNHRA PKD1L3 Exons 28-32 (SEQ ID NO: 9) KRNLLDTSIVLISFSILGLSMQSLSLLHKKMQQYHCDRDRFISFYEALRV NSAVTHLRGFLLLFATVRVWDLLRHHAQLQVINKTLSKAWDEVLGFILII VVLLSSYAMTFNLLFGWSISDYQSEFRSIVTVVGLLMGTSKHKEVIALYP ILGSLLVLSSIILMGLVIINLFVSAILIAFGKERKACEKEATLTDMLLQK LSSLLGIRLHQNPSEEH mouse PKD1L3 predicted mRNA (full-length) (SEQ ID NO: 10) ATGCTCTTGCAGAGGCGGTCCTGGCTCTGGGTGTACATTAGAATCGGTGTCATTCTGGGT GATATTTTGGGACGTAAACCAAGCATCCGGGAGCAACATGGGGGAAACAGCTGGTATCAG CTTAACAGACTTTTCTGTGACTTCCAGGAAGCAGATAACTACTGCCACGCCCAGAGAGGA CGCCTAGCCCACACGTGGAACCCCAAGGTTCGGGGTTTCCTAAAAAGCTTCCTGAATGAA GAAACAGTGTGGTGGGTCAGGGGAAACCTGACGCTGCCCGGATCGCATCCAGGGATAAAT CAGACAGGAGGTGATGACGTCTTAAGGAACCAAAAGCCTGGCGAGTGCCCTTCCGTGGTC ACACACTCTAATGCTGTCTTCTCAAGATGGAACCTGTGCATAGAGAAGCATCATTTCATT TGCCAGGCTGCCGCCTTTCCCCCTCAAGGTGCAAGCATTTGGAGAAATGAGTTTGGTCCT GGTCCTCTGTTACCCATGAAAAGAAGAGGAGCTGAGACAGAGAGACATATGATCCCAGGA AATGGCCCCCCGTTAGCCATGTGTCACCAACCCGCTCCTCCTGAGCTTTTTGAGACATTG TGCTTTCCCATTGACCCAGCTTCTTCAGCACCTCCAAAAGCCACACACAGGATGACAATC ACATCCCTAACTGGAAGGCCACAGGTGACATCAGACACACTTGCATCCAGCAGCCCACCA CAGGGGACATCAGAGACACCTGCATCCAGCAGCCCACCACAGGTGACATCAGCCACATCT GCATCTAGCAGCCCACCACAGGGGACATCAGACACACCTGCATCCAGCAGCCCACCACAG GTGACATCAGCCACATCTGCATCTAGCAGCCCACCACAGGGGACATCAGACACACCTGCA TCCAGCAGCCCACGACAGGTGACATCAGCCACATCTGCATCTAGCAGCCCACCACAGGGG ACATCAGACACACCTGCATCCAGCAGCCCACCACAGGTGACATCAGCCACATCTGCATCT AGCAGCCCACCACAGGGGACATCAGACACACCTGCATCCAGCAGCCCACCAGAGGGGACA TTAGACACACCTTCATCTAGCAGCCCACCACAGGGGACATCAGACACACCTGCATCCAGC AGCCCACCACAGGGGACATCAGAGACACCTGCATCCAACAGCCCACCACAGGGGACATCA GAGACACCTGGATTCAGCAGCCCACCACAGGTGACAACAGCCACACTTGTATCCAGCAGC CCACCACAGGTGACATCAGAGACACCTGCATCCAGCAGCCCAACACAGGTGACATCAGAG ACACCTGCATCCAGCAGCGCAACACAGGTGACATCAGACACACGTGCATCCAATAGCCCA CCACAGGGGACATCAGACACACCTGGATTCAGCAGCCCAACACAGGTGACAACAGCCACA CTTGTATCCAGCAGCCCACCACAGGTGACATCAGACACACCTGCATCCAGCAGCCCACCA CAGGTGACATCAGACACACCTGCATCCAGCAGCCCACCACAGGTGACATCAGAGACACCT GCATCCAGCAGCCCACCACAGGTGACATCAGACACATCTGCATCCATCAGCCCACCACAG GTAATATCAGACACACCTGCATCCAGCAGCCCACCACAGGTGACATCAGAGACACCTGCA TCCAGCAGCCCAACAAACATGACATCAGACACACCTGCATCCAGCAGCCCAACAAACATG ACATCAGACACACCTGCATCCAGCAGCCCAACAAACATGACATCAGACACACCTGCATCC AGCAGCCCACCATGGCCTGTTATAACAGAGGTCACCAGGCCTGAATCCACAATACCTGCT GGAAGATCTTTGGCAAACATCACTTCAAAGGCACAGGAAGACTCTCCCCTGGGAGTCATC TCTACCCATCCACAGATGTCATTTCAGAGTTCAACCAGTCAGGCCTTGGATGAGACAGCA GGGGAACGGGTCCCAACAATTCCTGATTTCCAAGCCCACAGTGAATTCCAGAAAGCTTGT GCCATCCTCCAGAGACTGAGAGACTTCCTGCCGACTTCTCCCACATCAGCTCAGGTCAGT GTGGCCAATTTACTCATTGACCTGAGTGAGCAGTTGCTGGTGCTCGCGTTTCAGAAGAAC AACAGTTGGAGCTCTCAAACTCCAGCAGTCAGCTGCCCCTTCCAGCCTCTTGGACGTCTA ACAACAACGGAAAAAAGCAGTCATCAGATGGCTCAGCAAGACATGGAACAGGTTGAAGAC ATGCTGGAGACATCCCTGATGGCCCTGGGGGAGATCCACAGAGCATTTTGCCAGGAGAGT CTGTGCCGTCAGTCAGCAGTGACCCTGGCCTCTCCCTCTGCTACTCTGATGTTGAGCAGC CAAAATGTGTCAACGTTGCCCCTGAGCACCTACACTTTGGGTGAGCCTGCACCCTTGACT TTGGGCTTCCCGTCAGCAGAAGCTCTGAAGGAGCTCTTGAACAAACACCCAGGGGTGAAC CTTCAAGTGACAGGTCTGGCTTTCAACCCTTTTAAGACTTTGGATGACAAGAACATTGTT GGAAGCATTGGAAATGTGCAGCTGAGCTCTGCTTATCAGTCGATCAGAGTCCACGACTTA ATAGAAGATATTGAGATCATGCTCTGGAGAAATGCCAGCATGGAGACCCAGCGCACCAGC CTCAACACAAGTACAGACCATTTCACAATCTCTGTGAACATCACTTCCTTGGAGAAGACC CTCATTGTGACCATCGAGCCTGAAAGTCCCCTCCTAATGACGCTCCACTTGGGCTTCCAG GACCAGCTGGCCCACACTCACTTCTATCTCAACATCAGCCTGCCAAGGGACCAAGTGTGG CAGAAAGATGAGGAGTACACGTGGGTGCTGACACCAGAGAACCTGTGGTACGGGACTGGC ACCTACTACATAATGGCTGTGGAGAATAAAAGTACAGAGGCGGCACAGCACACACCCGTC CTGGTCTCAGTGGTCACAGCTGTCACCCAGTGCTATTTCTGGGACCGATACAATAGGACA TGGAAGAGCGATGGATGCCAAGTGGGGCCGAAGAGCACCATTTTAAAGACACAGTGTCTC TGTGACCACCTGACCTTCTTCAGCAGCGACTTCTTCATCGTGCCGAGGACGGTGGATGTA GAAAACACCATCAAACTGCTTCTTCATGTGACCAACAACCCTGTCGGGGTGTCATTGCTG TCCAGCCTCCTAGGATTCTATATCCTCTTAGCCATGTGGGCTTCCAGAAAGGATCGAGAA GATATGCAGAAGGTGAAGGTAACAGTCCTGGCTGACAATGACCCCAGCTCTGCATCCCAC TACCTTATCCAGGTCTACACTGGCTATCGGAGGAGGGCTGCTACCACCGCCAAGGTCGTT ATCACTCTCTATGGCTCAGAGGGGCACAGTGAGCCCCAGCACCTTTGTGACCCTGAGAAG ACAGTTTTTGAGCGTGGAGCACTGGATGTTTTCCTTCTTTCCACCGGATCCTGGCTGGGG GACCTGCATGGCCTTCGGCTGTGGCATGACAATTCTGGCGACAGCCCTTCTTGGTATGTA AGCCAGGTGATCGTCAGTGACATGACCACGAGGAAGAAATGGCATTTCCAGTGCAATTGT TGGCTGGCCGTGGACTTGGGCAACTGTGAGCGTGACAGGGTGTTCACACCAGCCTCCAGA AGCGAGCTCTCTTCCTTCAGACACCTGTTCTCCTCCACAATCGTAGAAAAGTTCACCCAG GATTATCTGTGGCTCTCAGTTGCAACTCGACATCCCTGGAACCAGTTTACACGAGTCCAG AGGCTCTCCTGCTGCATGGCACTACTGCTCTGTGACATGGTCATCAATATTATGTTCTGG AAGATGGGTGGCACCACTGCCAAGAGGGGCACCGAACAACTAGGTCCACTTGCTGTGACC TTGTCGGAGCTGCTCGTCAGCATCCAGACCTCCATCATCCTCTTCCCCATCCACCTCATC TTTGGGCGGCTCTTCCAGTTGATTCACCCACCAGAAGCTCTGCCCCAGCTTCCTTTCATC CAGGCTGCCTGGCCCCCTGCTCTTGTTTGTGAGTCCCCCTCTCTTACACAGGTGGTCAAG GAATTAAAGGAAACTGTCGGATTCCTGCTCAGGAGAAATACACAGCTGCTCTCGGAGTGT GAGCCGTCTTCGTGCAGTTCTTGTGACATTAACAAGCTGGCGAAGCTTTTATCCGGCCTC ATTTACTGTCACTTAGAAGAGGAAGGCTGTCACCAGCAGACAGAATCCCACTGGGAAGAC GCAGTGTCTGAAAACCATTACCATTTCTGCCGCTACCTTCTCCAACTTCTGCGGAGACTG AAAGCGCATTTAGAGGGTCTTGGTGCTACCCAGGATCACCAGTCTTGTGATTTCTCAGAA GCAGTCAGCCAACTTCAAAACCTCCAGGAACTCCTGGAGACACAGACTCTCCGCAGAGGG CCAGGGCCATGCAGGCATTCCACCAGTTTCCCCATCCTCAGCCCAGGAGAAGGGAAGAAG CCCATGTCATTTTGCCTGTTCAGATGGTTGAAGTGCAGCTGCTGGCTCCTTCTTGGTGTC ATCAGCCTGGCCTCGGCCTTTTTTATAACGCTCTATAGCTTGGAGTTGGACAAAGACCAA GCCACCAGGTGGGTTATTTCAATGATGCTGTCGGTACTACAAGACATCTTTATCAGCCAG CCGATAAAGGTCATCTTCCTGACATTGTTGTTCTCCCTGATGGCAAACCACATGCCGTGG CTTAACAAAGACAAGGAACAACACGCCCGGAGAATCGTAGCACTTTGGGCAAAGTGTCCT TGGTCGGCACCTGGCTTGAGAGACAAGAACAATCCCATCTACACTGCCCCAGCAATGAAC AACCTAGCCAAGCCTACAAGGAAGGCCTGGAAGAAGCAGCTCTCCAAGCTGACGGGTGGT ACTCTGGTGCAAATCCTCTTCCTGACCCTGCTGATGACTACCGTCTATTCTGCAAAGGAC TCTAGTCGATTTTTCCTCCATCGAGCTATCTGGAAGAGGTTTTCTCACCGTTTCTCAGAA ATCAAAACTGTAGAGGATTTCTACCCCTGGGCCAACGGCACCCTCCTTCCTAACCTATAT GGGGATTACAGAGGATTTATTACTGACGGGAACTCCTTTCTTCTGGGCAATGTTTTGATC CGCCAGACTCGCATTCCTAATGACATATTCTTCCCAGGATCTCTCCACAAGCAAATGAAG TCGCCTCCCCAACATCAGGAGGACAGAGAGAACTATGGGGCTGGCTGGGTCCCCCCTGAC ACAAACATCACAAAAGTAGACAGTATTTGGCATTATCAGAATCAGGAGTCGCTGGGAGGC TATCCCATCCAAGGGGAGCTAGCCACTTACTCAGGAGGAGGCTATGTTGTGAGGCTTGGA AGAAACCACAGTGCGGCAACCAGGGTTCTGCAGCATCTGGAACAGAGGCGCTGGCTGGAC CACTGCACAAAAGCCCTCTTTGTAGAATTCACGGTCTTCAATGCTAATGTGAATCTGCTC TGTGCGGTGACCCTCATCTTGGAATCCAGTGGTGTGGGGACTTTCCTCACCTCCCTGCAA CTGGACAGTTTAACTTCCCTTCAGTCATCAGAGAGGGGCTTCGCCTGGATCGTCTCACAG GTCGTCTACTACCTTCTCGTCTGTTACTATGCCTTCATCCAGGGCTGTCGGCTGAAGCGG CAGAGGCTGGCGTTCTTCACTAGGAAAAGGAACCTCCTGGACACAAGCATCGTCCTCATT

AGCTTCAGCATCCTGGGCCTCAGCATGCAGAGCCTCTCTCTACTTCACAAAAAGATGCAG CAGTACCACTGTGACCGGGACAGGTTCATCAGTTTCTACGAGGCACTGAGAGTGAACTCT GCAGTCACCCACCTCAGGGGCTTCCTGCTTCTCTTCGCAACTGTGCGGGTCTGGGACCTA CTGCGACATCATGCCCAGTTACAGGTCATCAACAAGACACTGTCCAAAGCCTGGGACGAG GTGCTGGGCTTTATACTGATCATCGTGGTCCTGTTAAGCAGCTATGCCATGACTTTCAAC GTGCTGTTTGGATGGAGCATCTCTGACTACCAGAGCTTCTTCAGATCTATAGTGACTGTT GTTGGCCTCTTGATGGGAACTTCAAAGCACAAGGAGGTTATTGCTCTATACCCAATCCTG GGCTCCCTTTTGGTTCTCAGTAGCATCATCTTGATGGGACTTGTGATCATTAATCTTTTT GTTTCTGCCATTCTCATTGCCTTTGGGAAAGAAAGGAAGGCCTGTGAGAAAGAAGCTACA CTGACAGATATGTTACTACAAAAGCTCTCAAGTCTGTTAGGAATCCGCCTGCACCAGAAT CCATCTGAGGAACACGCTGACAACACTGGGTATTGA human PKD1L3 predicted mRNA sequence (full-length) (SEQ ID NO: 11): ATGTTCTTCAAAGGAGGAAGCTGGCTTTGGTTATACATCAGAACAAGTATTATTCTAGGA AGTGAGCTAAACAGCCCAGCACCACATGGGCAAAATAATTGTTACCAGCTTAACAGATTT CAATGCAGCTTTGAGGAAGCACAGCATTACTGTCATGTGCAGAGAGGATTCCTAGCTCAT ATTTGGAACAAGGAAGTTCAAGATCTCATCCGGGACTATCTGGAAGAAGGAAAGAAGTGG TGGATTGGGCAAAATGTAATGCCATTGAAAAAGCATCAAGACAACAAATACCCAGCAGAC GTTGCAGCCAACGGGCCCCCAAAGCCCCTCAGCTGCACCTACCTGTCCAGAAACTTCATT CGGATCTCATCCAAAGGGGACAAGTGCTTACTGAAATACTATTTCATTTGCCAGACTGGT GACTTTTTGGACGGAGATGCCCATTATGAAAGAAATGGAAATAATTCCCATTTGTACCAG AGACACAAGAAGACAAAAAGAGGAGTTGCAATAGCAAGAGACAAAATGCCCCCAGGACCT GGTCATCTTCCAACCACATGTCACTATCCTCTTCCTGCTCATCTTTCCAAGACCCTGTGT CATCCCATCAGCCAGTTTCCTTCAGTACTATCAAGTATCACATCACAGGTAACATCAGCC GCATCTGAACCCAGCAGCCAGCCTCTCCCTGTGATAACACAGCTCACCATGCCCGTGTCT GTCACGCATGCTGGGCAATCTCTGGCAGAAACAACTTCAAGCCCAAAGGAAGAAGGTCAT CCGAATACCTTCACCTCTTATCTACAAGTGTCATTGCAGAAGGCATCTGGTCAGGTCATA GATGAGATAGCAGGGAACTTCAGCAGAGCAGTTCATGGTTTGCAAGCTCTTAACAAACTA CAGGAAGCTTGTGAGTTCCTCCAGAAACTAACAGCCTTAACCCCAAGATTTTCTAAGCCA GCTCAGGTTAATCTCATCAATTCCCTTATTTACCTGAGTGAGGAGTTACTCAGGATCCCA TTTCAGAACAACAACAGTCTGGGCTTCAAAGTTCCTCCAACTGTCTGCCCCTTTCATTCC CTCAACAATGTCACCAAAGCTGGAGAAGGAAGTTGGCTGGAATCCAAGCGTCATACTGAG CCGGTAGAAGACATCCTGGAAATGTCCTTGGTGGAGTTTGGGAATATCGGGGAAGCATTT CTAGAGCAGAACCAGTCTCCCGAGTCTTCAGTGACTTTGACCTGTGCCAATGCTACTCTG CTGCTGAGCAGACAAAACATATCAACTTTACCGCTGAGCTCTTACACTCTGGGTCACCCA GCCCCTGTGAGGCTAGGCTTTCCGTCGGCTTTAGCTTTGAAGGAGCTCTTGAATAAACAT CCAGGAGTTAATGTCCAAATAACAGGACTAGCTTTCAATCCCTTCAAGGATTTGGACAAC AGAAACATTGTTGGAAGCATTGGAAGTGTGTTACTAAGCGCTAATCGTAAATTGCTCCAA GTCCATGATTTAATGGAGGACATTGAGATCATGCTCTGGAGAAATGTTAGCTTGGAAACC CATCCCACCAGCCTCAACATGAGCACACATCAGCTTACAATCACAGTGAACGTCACTTCC TTGGAGAAATCCTTGATAGTGAGCATAGATCCTGACAGTCCCCTTTTAATGACACTCTAC CTGGGGTTCCAGTATCAGCCTAACTGCACTCACTTCCACCTGAACATCACCCTTCCAAAG GATAAGGTGTGGCAAAAAGATGAGGAGTACACGTGGGTGCTGAATCCAGAGCATCTGCAG CACGGGATTGGCACCTACTATATAACAGCTGTGCTGAGTGAGAGGCAGGAGGGTGCTCAG CAGACACCCAGCTTGGTCTCGGTCATCACCGCCGTCACTCAGTGTTACTACTGGGAGATC CACAAGCAGACATGGAGCAGCGCCGGATGCCAAGTTGGGCCACAGAGCACAATTCTGAGG ACACAGTGTCTCTGTAACCACCTGACCTTCTTTGCCAGCGACTTCTTTGTCGTGCCCAGG ACCGTGAATGTTGAAGACACGATCAAACTGTTCCTTCGCGTGACCAACAATCCTGTTGGG GTGTCACTGCTGGCCAGCCTTTTAGGATTTTATGTGATCACAGTTGTGTGGGCTCGGAAA AAGGATCAAGCAGATATGCAGAAGGTGAAGGTCACTGTCCTGGCTGATAATGACCCCAGC GCTCAATTTCACTACCTTATTCAGGTCTACACCGGATATCGAAGAAGCGCTGCTACAACA GCTAAGGTTGTCATCACCCTCTATGGATCAGAGGGACGGAGTGAGCCCCATCACCTCTGT GACCCCCAGAAGACAGTCTTTGAACGAGGGGGCCTGGATGTCTTCCTTCTCACCACTTGG ACCTCTCTAGGGAACCTGCACAGCCTTCGGCTCTGGCATGACAATTCTGGCGTCAGTCCC TCCTGGTATGTCAGCCAGGTAATTGTCTGTGACATGGCAGTTAAGAGGAAGTGGCATTTC CTGTGCAATTGCTGGCTGGCTGTGGACCTCGGAGACTGTGAGCTTGACCGGGTCTTCATC CCAGTTTCAAAGAGAGAGCTCTTTTCCTTTAGACATCTGTTTTCCTCCATGATTGTGGAA AAGTTCACCCAGGATTATCTGTGGCTTTCAATTGCAACTCGGCATCCCTGGAACCAGTTT ACAAGGGTCCAACGGCTGTCTTGCTGCATGACACTGCTACTCTGCAACATGGTCATCAAT GTTATGTTCTGGAAGATAAACAGCACCACTGCCAAGAGAGATGAGCAAATGCGTCCATTT GCTGTGGCCTGGTCTGAACTGCTGGTCAGCATCCATACTGCTGTCATCCTCTTCCCAATC AATCTTGTCATAGGGCGGCTCTTCCCGTTGATTGAGCCACAGGAGACTCTGCCCCTCTTT CCTCCCATCCAGGCCTCCTGCCTCTCAGATGCTTCTGTTGAGCCTCTCTCTGCCACAATG GTAGTTGAGGAATTAAAGGAAACTGTGAGATTCCTGCTCAGGAGAAATACATACCTACTC TCCAAGTGTGAGCAGCCGCCATGGAGTTCTTGGGACATTACTAAGCTGGTGAAACTTTTA TCCAGCCTCGTATCATCTCACTTGGAGGGTCAAGGCTGTCATCAGCAGGGAGAGCGCCAC TGGGCACGTGTTGTTCCTGAAAACCACCATCATTTCTGCTGTTACCTGCATAGAGTTCTG CAGAGGCTGAAATCTCACTTAGGCACGCTGGGTCTCACCCAGGGTCACCAGTCCTGTGAC TTCCTAGATGCAGCCAGCCAACTTCAAAAACTCCAGGAACTCTTGGAAACACATATTCTT CCCACGGAGCAAGAGCCATCCAGGGAAGTCACCAGTTTTGCCATCCTGAGCTCAGAAGAA GGAAAAAAGCCCATCTCAAATGGCCTGTCCAAATGGTTGACTTCAGTCTGCTGGCTCCTC TTAGGTTTCACTAGCCTGGCTTCAGCCTTTTTTACAGCACTTTATAGCTTGGAATTGAGC AAAGACCAAGCCACCAGCTGGATGATTTCAATTATTTTATCAGTGCTTCAGAACATCTTC ATCAGCCAGCCAGTAAAGGTGGTCTTCTTCACATTCTTATACTCACTGATGATGAGCAGG ATGCCACGGCTTAACAAAGAGAATGAACAACAAAGGATCTTGGCACTCTTGGCAAAATGT TCTTCGTCAGTACCAGGTTCAAGAGATAAGAACAACCCCGTCTATGTAGCCCCAGCTATA AATAGTCCAACTAAGCACCCAGAAAGAACCTTGAAAAAGAAGAAACTCTTCAAGCTGACT GGAGATATTTTGGTACAAATCCTCTTCCTTACCCTGTTGATGACTGCAATCTACTCTGCA AAGAACTCCAATAGATTTTACCTCCACCAAGCTATCTGGAAGACATTTTCGCACCAGTTC TCGGAAATCAAACTTCTTCAGGATTTCTACCCCTGGGCCAATCATATCCTTCTTCCTAGC CTGTATGGGGATTACAGAGGTAAGAATGCAGTCCTGGAGCCCAGTCATTGCAAATGTGGG GTACAATTAATTTTCCAAATACCCCGTACCAAGACCTATGAGAAAGTGGACGAAGGTCAG CTGGCGTTTTGTGATAACGGCCATACCTGTGGGCGTCCCAAGAGCCTATTCCCTGGACTT CATCTAAGGAGGTTCAGTTACATCTGTTCACCCAGGCCCATGGTGCTGATTCGCACTGAT GAGCTTGACGAAAGGCTGACAAGCAAGAATGAGAATGGATTCAGTTACATCATGAGAGGT GCTTTCTTCACCTCTTTGAGACTGGAAAGCTTCACTTCCCTTCAGATGTCAAAGAAGGGC TGTGTCTGGTCTATCATCTCACAAGTCATCTATTATCTACTGGTCTGTTACTATGCCTTC ATACAGGGTTGTCAGCTGAAACAGCAGAAGTGGAGGTTCTTCACTGGGAAAAGAAACATT CTGGACACAAGTATAATCCTCATTAGCTTCATCCTCCTGGGGCTTGACATGAAGAGTATT TCTCTACATAAGAAAAACATGGCACGATACCGCGATGACCAGGACAGATTCATCAGCTTC TATGAGGCAGTAAAAGTGAACTCTGCTGCGACTCACCTTGTGGGCTTCCCGGTTCTCCTG GCAACTGTTCAGTTATGGAACCTGCTGCGTCATAGCCCCAGGCTGCGGGTGATCAGCAGG ACACTGAGCCGAGCCTGGGACGAGGTGGTGGGCTTTCTGCTGATCATCCTAATCCTGCTG ACAGGCTATGCCATTGCCTTTAACCTGCTGTTTGGATGCAGCATCTCTGACTACCGGACA TTTTTCAGCTCAGCAGTGACTGTTGTTGGTCTCCTGATGGGAATTTCTCACCAAGAGGAG GTTTTCGCTTTAGACCCAGTCCTGGGCACCTTTCTGATCCTCACCAGTGTCATCTTGATG GTACTTGTGGTAATTAATCTTTTCGTTTCGGCCATTCTCATGGCCTTTGGAAAAGAAAGA AAGTCGCTTAAGAAAGAAGCTGCACTAATAGATACACTGCTACAGAAGCTCTCAAATTTG TTAGGAATCAGTTGGCCCCAAAAAACCTCATCTGAGCAAGCAGCCACGACAGCAGTGGGC AGTGACACTGAAGTTTTAGATGAACTACCTTAA

Example 3

A Common Sensor for Acid Detection in the Tounge and Spinal Cord

[0286]Mammals taste many compounds, yet use a sensory palette consisting of only five basic taste modalities: sweet, bitter, sour, salty, and umami (the taste of monosodium glutamate).sup.1,2. While this repertoire may appear modest, it provides animals with critical information about the nature and quality of food. Sour taste detection functions as an important sensory input to warn against the ingestion of acidic (e.g. spoiled or unripe) food sources.sup.1-3. We have used a combination of bioinformatics, genetic, and functional studies to identify PKD2L1, a polycystic kidney disease-like ion channel.sup.4, as a candidate mammalian sour taste sensor. In the tongue, PKD2L1 is expressed in a subset of taste receptor cells (TRCs) distinct from those responsible for sweet, bitter and umami taste. To examine the role of PKD2L1-expressing taste cells in vivo, we engineered mice with targeted genetic ablations of selected populations of TRCs. Animals lacking PKD2L1-cells are completely devoid of taste responses to sour stimuli. Notably, responses to all other tastants remained unaffected, proving that the segregation of taste qualities even extends to ionic stimuli. Our results now establish independent cellular substrates for four of the five basic taste modalities, and support a comprehensive labeled-line mode of taste coding at the periphery.sup.5-10. Interestingly, PKD2L1 is also expressed in specific neurons surrounding the central canal of the spinal cord. Here we demonstrate that these PKD2L1-expressing neurons send projections to the central canal, and selectively trigger action potentials in response to decreases in extracellular pH. We show that these cells correspond to the long sought components of the cerebrospinal fluid chemosensory system.sup.11. Taken together, our results suggest a common basis for acid sensing in disparately different physiological settings.

[0287]A broad range of cell types, receptors and mechanisms have been proposed to mediate salt and acid sensing in TRCs.sup.1-3. These include the activation of ENaCs, ASICs, K2P channels, H.sup.+-gated calcium channels, as well as the involvement of Na.sup.+--H.sup.+-exchangers, TRPV pain receptors, and even acid-inactivation of K.sup.+-channels.sup.1-3,12-14. Significantly, most of these proteins are broadly expressed in TRCs and other tissues. In contrast, we previously isolated and characterized the receptors for sweet, umami and bitter taste.sup.5-7,15-17, and showed that each of these three taste modalities is mediated by highly selective receptor proteins expressed in distinct and independent populations of taste receptor cells.sup.5-10. Therefore, we reasoned that salt and sour taste should also be mediated by highly selective dedicated cells, and consequently expected the receptor proteins to be very exclusive in their expression pattern.

[0288]To identify novel taste receptors, we developed a multi-step bioinformatics and expression screening strategy (see also, Examples 1 and 2). First, since sensory receptors are expected to be membrane proteins, approximately 30,000 mouse open reading frames (ORFs) were scanned for the presence of at least one putative transmembrane segment. Second, because taste receptors are predicted to be very restricted in their expression pattern, ORFs encoding candidate transmembrane proteins were cross-searched against mouse EST databases to eliminate those broadly expressed. Next, to identify the subset specifically enriched in taste tissue, ORFs selected as encoding transcripts infrequently represented in EST databases (.about.880 candidates) were used in RT-PCR reactions templated with mRNA from TRCs versus control tongue epithelium. Finally, given that our goal was to discover membrane proteins selectively expressed in subsets of TRCs (and ideally not in sweet, bitter or umami sensing cells), we carried out detailed in situ hybridizations against taste papillae. Of 26 cDNAs used in situ studies, five were found to robustly and selectively label subsets of TRCs. FIG. 8 shows that one of these candidates, PKD2L1 is expressed in TRCs of all taste papillae, including fungiform, circumvallate, foliate and palate taste buds (further figure details are found below).

[0289]PKD2L1 encodes a polypeptide displaying significant amino acid sequence similarity to PKD2.sup.4, a gene mutated in many cases of autosomal dominant polycystic kidney disease.sup.18,19. PKD2s are members of the TRP superfamily of ion channels.sup.20, and have been recently shown to function as non-selective cation channels when expressed in heterologous cells.sup.18,19,21. While the exact roles of PKDs remain unknown, they are believed to function as receptor/ion-channel complexes, often localized to ciliated compartments, and implicated in sensing extracellular signals (e.g. in renal epithelial cells.sup.18,19). We reasoned that if PKD2L1 has a specific role in taste it should be expressed in subpopulations of taste receptor cells with unique functional characteristics. To determine which type of TRCs express PKD2L1, we performed double labeling experiments with sweet, umami and bitter taste receptors (T1R5 and T2R5), as well as TRPM5, the transduction channel of sweet, bitter and umami sensing cells. Our results (FIG. 8) established that PKD2L1 is expressed in cells distinct from those mediating sweet, umami and bitter taste (see also.sup.22). FIGS. 1 and 8 show that PKD2L1 is expressed in a novel population of TRCs. As shown in FIG. 8, in situ hybridization (PKD2L1, PKD1L3, T1Rs, T2Rs and TRPM5) and double-label fluorescent immunohistochemistry (PKD2L1) were used to directly examine the overlap in cellular expression of taste receptors, TRPM5, PKD2L1 and PKD1L3. Panel A shows in situ hybridization of PKD2L1 and PKD1L3 against circumvallate, foliate, fungiform and palate taste buds, illustrating expression of PKD2L1 in subsets of TRCs of all taste buds, but a total lack of PKD1L3 in fungiform and palate TRCs. Approximately 20% of taste cells express PKD2L1. Dotted lines show the outline of sample taste buds. Panel (b) shows that PKD2L1 is not expressed in sweet, umami or bitter cells. The first three panels show co-labeling with a PKD2L1 antisense RNA probe and T1R3 (T1R, sweet and umami cells), a mixture of 20 T2Rs (bitter cells), and TRPM5 (sweet, umami and bitter cells), respectively. The last panel shows co-labeling with anti-PKD2L1 antibodies and an antisense PKD1L3 RNA probe. Note the absence of overlap between PKD2L1-expressing cells and those expressing sweet, umami or bitter receptors. However, PKD1L3 is always co-expressed with PKD2L1 in CV and foliate papillae.

[0290]Mammalian taste receptor cells project specialized apical microvilli to the taste pore, the site of interaction between tastants and taste receptor proteins. All known taste receptor proteins localize to, and function, in this TRC compartment.sup.1,5-7,15,17,23. Therefore we would expect bona-fide candidate receptors to also be enriched in the taste pore. We generated antibodies to PKD2L1 and used them in immunofluorescence staining of tongue tissue sections. Examination of CV, foliate and fungiform papillae demonstrated that PKD2L1 protein is indeed enriched in the apical surface of taste receptor cells, with the antibodies robustly labeling the taste pore region (FIG. 9). These results implicate PKD2L1 as part of the taste sensing machinery.

[0291]PKD2 isoforms often require PKD1s for functional expression at the cell surface.sup.18,19,21. The mammalian genome contains 4 members of the PKD1 family: PKD1, PKD1L1, PKD1L2 and PKD1L3.sup.18,19. We performed in situ hybridization studies with gene specific probes representing each family member, and determined that PKD1L3 is specifically co-expressed with PKD2L1 in CV and foliate TRCs (FIG. 8, see also, Example 2, and.sup.22). We also generated antibodies to PKD1L3 and demonstrated selective co-expression with PKD2L1 in non-TRPM5 expressing cells of the CV and foliate (FIG. 9). Surprisingly, PKD1L3 transcript or protein is not detectable in fungiform or palate taste buds (FIGS. 8 and 9), suggesting that a different partner may be expressed in those TRCs.

[0292]If PKD2L1 is a mammalian taste receptor, we expect two basic criteria to be met. First, PKD2L1-expressing TRCs should mediate a specific taste quality in vivo. Second, PKD2L1 protein should be activated in response to taste stimuli.

[0293]To functionally dissect the role of PKD2L1-expressing cells in the tongue, we engineered mice where these cells were genetically ablated by targeted expression of attenuated diphtheria toxin.sup.24 (DTA). To validate this approach as a means of uncovering TRC function, we first generated mice where T1R2-regulatory sequences were used to target DTA expressions. T1R2 is an essential subunit of the sweet receptor heterodimer (T1R2+3), and the selective ablation of these cells should generate animals with a specific loss of sweet taste.sup.6,9,10,17. To investigate the taste responses of the genetically modified mice, we recorded tastant-induced action potentials from nerves innervating taste receptor cells of the tongue; this physiological assay monitors the activity of the taste system at the periphery, and provides an accurate and reliable measure of taste receptor cell function. Indeed, animals expressing DTA in T1R2 cells have an extraordinary loss of sweet, but importantly retain umami, bitter, sour and salty tastes FIG. 5, panel A). These results further substantiate the exquisite segregation of taste modalities at the periphery, and demonstrate the utility of using DTA-mediated ablation of TRCs as a strategy for dissecting taste system function. Next, we engineered animals where the PKD2L1 gene was used to target Cre recombinase into PKD2L1-expressing cells; appropriate expression was confirmed by performing double labeling with Cre and probes specific to PKD2L1-cells, or by crossing them to GFP reporter lines.sup.26. Mice expressing Cre in PKD2L1 cells were crossed to conditional DTA lines, and double-positive progeny were scrutinized both for the specificity and efficiency of killing, as well as the integrity of taste buds. We checked the expression of T1Rs, T2Rs, and TRPM5.sup.8,27 in control and DTA-expressing animals, and found no significant differences in the number or distribution of T1R- or T2R-positive cells between wild type and ablated taste tissue. In contrast, the DTA-targeted mice had a profound and practically complete loss of PKD2L1-expressing TRCs in the tongue. Remarkably, genetic ablation of the PKD2L1-expressing cells produces animals with a devastating loss of sour taste (FIG. 5, panels A and B). Responses to all acid tastants, including citric acid, HCl, tartaric acid and acetic acid are completely abolished, with no significant activity over a range of 5 orders magnitude of proton concentrations. However, responses to sweet, umami, bitter or salty tastants remain indistinguishable from wild type control animals. These results firmly establish PKD2L1-expressing cells as the sour taste sensors, and further substantiate a model of coding at the periphery in which individual taste modalities operate independently of each other.

[0294]Acid sensing is important not only in the taste system, but also for monitoring the functional state of body fluids, including the internal milieu of the brain. This is particularly well-studied in the central and peripheral control of respiration, where pH sensing is the principal mechanism for monitoring CO.sub.2 levels in the blood and cerebrospinal fluid.sup.11,28,29 (CSF). Thus, we wondered whether PKD2L1 might be expressed in additional cell types, and if so whether such cells may also be involved in pH sensing in other physiological systems.

[0295]We carried out in situ hybridization and antibody staining experiments with PKD2L1 on a wide range of other tissues and identified a singular additional domain of expression: a discrete population of neurons surrounding the central canal of the spinal cord, through its entire length, from its origin in the brain stem to its end around the cauda equina (FIG. 6). Notably, these neurons send processes into the central canal, suggesting they may function as chemoreceptors sensing the internal state of the CSF (FIG. 6, e.g., panels b and g.sup.11). Given their anatomical distribution and cellular morphology, we reasoned these cells might be part of the homeostatic circuitry responsible for monitoring and reporting the pH of the cerebrospinal fluid. This postulate predicts that these neurons should trigger action potentials in response to acid stimulation. Therefore, we engineered mice where a GFP reporter was targeted to PKD2L1-expressing cells, and performed patch clamp recordings from GFP-labeled cells in a spinal cord slice preparation.sup.30. A priori, we anticipated some notable differences in the behavior of these cells compared to TRCs; while the taste system is tuned to respond to acid stimulation in the range of multiple pH units (i.e. pH 2-5), we expected the CSF monitor cells to respond to pH changes within a range of a few tenths of deviation from pH 7.4. Indeed, FIG. 7 shows that the PKD2L1-expressing neurons display exquisite sensitivity and selectivity to pH stimulation. Exposure to test solutions between pH 6.5 and 7.4 evoked a dramatic, dose dependent, and reversible increase in action potential (AP) frequency (FIG. 7). In contrast, the same acid stimuli have no significant impact on the response of control (e.g. unlabeled) cells, even after exposure to pH as low as 6.5 (lower pHs triggered irreversible damage to the slice preparation).

[0296]Most of the known CSF-contacting neurons in mammals project ciliated dendrites into the CSP, where they are proposed to sense fluid flow, pressure, pH or the composition of the CSF.sup.11. Our demonstration that PKD2L1-expressing cells of the spinal cord selectively fire in response to minor changes in proton concentration strongly suggests that they function as sentinels of cerebrospinal and ventricular pH. Collectively, these results assign an entirely unexpected role to members of the PKD family of proteins, offer a new perspective into the potential significance of PKD2s in health and disease, and bring forth a surprising unity in the cellular basis of pH sensing in very different physiological systems. It is useful to develop an activity assay for PKD2L1 to establish the molecular mechanism of acid activation, to study the phenotype of PKD2L1 knockout animals, and determine whether PKD2L1 functionally associates or interacts with different partners in different cells types. In this regard, it would be worth exploring whether the differences in pH sensitivity between the tongue and spinal cord might be due to differences in PKD2L1-receptor complex composition.

[0297]The nature of the mammalian sour taste receptor and sour-sensing TRCs have been fertile ground for speculation over the years. A wide range of cell types, receptors, and even receptor-independent mechanisms, have been proposed to mediate acid detection in the tongue.sup.1-3. The results presented in this paper establish that sour taste, much like our previous findings for sweet, umami and bitter is mediated by a unique cell type, independent of all other taste qualities. In addition, our demonstration that sour-less mice have normal salt responses demonstrates that salt taste is also mediated by independent TRCs. Together, these results impose a considerable revision of the current views of taste representation at the periphery, and make a compelling case for a labeled line mode of coding across all five taste modalities and TRC types.

[0298]Accordingly, several lines of evidence now strongly implicate PKD2L1 as encoding a receptor protein. First, expressed PKD2L1 mRNA and polycystin-2L1 selectively localize to the taste pore region of TRCs. Second, the presence of polycystin-2L1 protein functionally marks cells as acid chemosensors, both in the tongue and in the nervous system. Finally, ablation of PKD211-expressing cells selectively eliminates pH-sensing in the tongue. It is of interest to further study the phenotype of PKD2L1 knockout animals, to establish the molecular mechanism of acid activation, and to further determine whether PKD2L1 functionally associates or interacts with different partners in different cells types. In this regard, it would be worth exploring whether the differences in pH sensitivity between the tongue and spinal cord might be due to differences in PKD2L1-receptor complex composition.

ADDITIONAL EXAMPLE DETAILS

Molecular Cloning of PKD2L1

[0299]We used a strategy that combined bioinformatics and differential screening to isolate genes specifically expressed in taste receptor cells. Mouse genomic sequence information was obtained from Ensembl Mm.30 (http://www.ensembl.org). Approximately 30,000 predicted protein sequences were screened for the presence of at least one putative transmembrane segment, using both TMHMM server version 2.0 (http://www.cbs.dtu.dk/services/TMHMM-2.0/) and f_TMHMM (San Diego Supercomputer center, http://www.sdsc.edu/pb/Group.html). The cDNA sequence for each candidate membrane protein was then extracted from NCBI (http://www.ncbi.nlm.nih.govlblast/blastcgihelp.shtml#nucleotide_database- s) and used to screen EST databases (http://www.ncbi.nlm.nih.gov/dbEST/index.html). Only EST hits with e-values of less than or equal to e.sup.-100 were considered in our analysis. A total of 884 genes expressed in 3 tissues or less were chosen for PCR reactions with cDNA prepared from taste papillae mRNA (CV and foliate) and from surrounding non-taste epithelial tissue (non-taste control). To ensure specificity of the PCR reactions, all primers sets included unique 3'UTR sequences (http://frodo.wi.mit.edu/cgi-bin/primer3/primer3_www.cgi.). A total of 98 genes showed selective enrichment in taste versus non-taste tissue, and of these five were robustly expressed in subsets of TRCs. Full length clones were isolated from mouse taste cDNA libralies.sup.23. See also, Examples 1 and 2.

[0300]In Situ Hybridization and Immunostaining

[0301]Fresh frozen sections (16 .mu.m/section) were attached to silanized slides and prepared for immunohistochemistry or in situ hybridization as described previously.sup.23. In situ hybridizations were carried out using digoxigenin or fluorescein labeled probes at high stringency (hybridization, 5.times.SSC, 50% formamide, 65-72.degree. C.; washing, 0.2.times.SSC, 72.degree. C.). For single-label detection, signals were developed using alkaline phosphatase-conjugated antibodies to digoxigenin and standard chromogenic substrates. Double-label fluorescent detection utilized an alkaline phosphatase-conjugated anti-fluorescein antibody and a horseradish peroxidase-conjugated anti-digoxigenin antibody in combination with fast red and tyramide fluorogenic substrates.sup.23.

[0302]Anti-peptide antibodies to PKD2L1 (KLKMLERKGELAPSPGMGE), PKD1L3 (DFQEADNYCHAQRGRLAHT), and TRPM5.sup.8 were generated in rabbits and purified as described previously.sup.31. Images were obtained using either a Leica SP2 TSC or a Zeiss 510 Meta confocal microscope; 1-2 .mu.m optical sections were recorded to ensure that any overlapping signal originated from single cells. For double label experiments, in situ hybridization was carried out before immunohistochemical detection.

[0303]Transgenic Animals

[0304]Transgenic lines were produced by pronuclear injection of zygotes from FVB/N or CB6 (BALB/c.times.C57BL/6 hybrids) mice. The PKD2L1-IRES-Cre construct was generated in RP23-297K23 and the T1R2--IRES-Cre in RP23-348G10 (http://bacpac.chori.org/) using a 4 kb IRES-Cre cassette (gift from Dr. Kevin Jones). Recombination was carried out exactly as described previously.sup.32. All products were characterized by restriction analysis and direct sequencing to ensure fidelity of the recombination event and junctional sequences. Z/EG reporter lines.sup.26 were obtained from Jackson Laboratories (Bar Harbor, Me.; Novak et al., 2000), and Rosa26-flox-lacZ-flox-DTA animals.sup.25 were a generous gift of Dr. Dieter Riethmacher.

[0305]Nerve Recordings

[0306]Lingual stimulation and recording procedures were performed as previously described.sup.7,9. Neural signals were amplified (10,000.times.) with a Grass P511 AC amplifier (Astro-Med), digitized with a Digidata 1200B A/D converter (Axon Instruments), and integrated (r.m.s. voltage) with a time constant of 0.5 s. Taste stimuli were presented at a constant flow rate of 4 ml min.sup.-1 for 20 s intervals interspersed by 2 min rinses with artificial saliva.sup.7,9 between presentations. All data analyses used the integrated response over a 25 s period immediately after the application of the stimulus. The mean response to 60 mM AceK was used to normalize responses to each experimental series. Tastants used for nerve recordings were: 10 mM, 60 mM acesulfameK (AceK); 10 mM, 60 mM sodium saccharin (saccharin); 300 mM sucrose; 30 mM mono potassium glutamate+1 mM inosine mono phosphate (Glu); 30 mM L alanine+1 mM inosine mono phosphate (Ala); 10 mM quinine hydrochloride (Qui); 100 .mu.M cycloheximide (Cyx); 10 mM 6-n-propyl 2-thiouracil (PROP); 50 mM, 100 mM sodium chloride (NaCl); 10 mM, 50 mM citric acid; 10 mM, 50 mM tartaric acid; 50 mM, 500 mM acetic acid; pH 2 hydrochloric acid (HCl); 10 mM citric acid pH 2, 4 and 6.

[0307]Spinal Cord Slice Recordings

[0308]Electrophysiological experiments were performed on P1-P4 mice as previously described.sup.30. Spinal cord slices 250-300 .mu.m thick were generated using a Vibratome.RTM. 3000 Plus at 0-4.degree. C. in a modified Ringers' solution (0.5 mM CaCl.sub.2, 3.7 mM MgSO.sub.4). After at least a 1 h recovery period, slices were transferred to a recording chamber and perfused with oxygenated Ringers' solution (pH 7.4) at room temperature. Loose-patch and whole-cell patch clamp recordings from GFP-labeled and unlabeled cells were performed using an EPC-10/2 amplifier and Patchmaster software (HBEKA Electronik). Slices were stimulated with a solution containing 140 mM NaCl, 3 mM KCl, 1.3 mM MgSO.sub.4, 2.5 mM CaCl.sub.2, 10 mM glucose, 10 mM HEPES at various pH (7.4, 6.9, 6.5).

Additional Figure Details

[0309]FIG. 5A-B: PKD2L1-expressing TRCs are the mediators of sour taste. (a) Targeted expression of attenuated diphtheria toxin to selective populations of TRCs produces animals with selective deficits in taste responses. Wild-type mice (WT) show robust neural responses to sweet (saccharin and acesulfameK, AceK), bitter (quinine), amino acid (glutamate), salty (NaCl) and sour tastants (citric acid, acetic acid and hydrochloric acid, HCl). However, ablation of sweet cells (T1R2-expressing TRCs) generates animals with a dramatic loss of sweet taste (middle panel). In contrast, ablation of PKD2L1-expressing cells eliminates responses to all acid stimuli (bottom panel). Importantly, responses to all other taste qualities remain unimpaired in the DTA-expressing animals. Shown are integrated chorda tympani responses normalized to the response to 60 mM AceK; see herein for details on the ablated lines and concentrations of tastants. (b) Average neural responses of animals lacking PKD2L1-expressing cells to an expanded panel of tastants; note normal responses to sweet, umami, bitter and salt stimuli. Wild type, black bars; PKD2L1-DTA, outline bars. The values are means.+-.s.e.m. (n=5) of normalized chorda tympani responses. (c) Quantitation of acid responses of wild type (gray bars) and PKD2L1-DTA animals (outline bars). The values are means.+-.s.e.m. (n=6).

[0310]FIG. 6: PKD2L1 is expressed in neurons contacting the central canal of the spinal cord. (a-b) Antibody labeling with anti-PKD2L1 antibodies reveals a population of a population of PKD2L1 expressing neurons surrounding the central canal of the spinal cord. (b) expanded view of dotted area from panel (a). (c-d) The PKD2L1-expressing cells are found throughout the entire length of the spinal cord. Shown are in situ hybridization experiments with PKD2L1 specific probes on a sagital section of a P1 mouse. Section shown corresponds approximately to boxed area in panel (c). (e-f) PKD2L1-expression extends through the brain stem and into the IV ventricle (IV). There is also a very small group of positive cells in the hypothalamus. (g) PKD2L1-expressing neurons project into the central canal; note robust expression of PKD2L1 receptors at the terminals. Shown are immunofluorescent stainings with anti-PKD2L1 antibodies; cc refers to central canal.

[0311]FIG. 7: PKD2L1-expressing neurons of the central canal fire action potentials in response to pH stimulation Spinal cord neurons were patched using a loose patch configuration.sup.30, tested for the presence of basal activity and recorded in the cell-attached configuration. (a) GFP-expressing (PKD2L1-positive cells) or unlabeled (control) cells were examined for pH responses under a perfusion regime consisting of pH 7.4, pH6.9, pH 7.4 and pH 6.5. (b) Shown are AP traces in a window of .about.10 sec following exposure to test solutions at pH 7.4, 6.9 and 6.5. Note the dramatic increases in firing frequency in GFP-labeled cells. (c) Data was analyzed by examining records of .about.4 minutes at each pH condition; spike sorting software (Axon Instruments) was used to calculate AP frequencies. Basal activity ranged between 1-5 Hz. A minimum of 8 GFP-labeled and 5 unlabelled cells were characterized for each stimuli. The values are means.+-.s.e.m. normalized to basal activity at pH 7.4.

[0312]FIG. 8: PKD2L1 is expressed in a novel population of TRCs. In situ hybridization (PKD2L1, PKD1L3, T1Rs, T2R5 and TRPM5) and double-label fluorescent immunohistochemistry (PKD2L1) were used to directly examine the overlap in cellular expression of taste receptors, TRPM5, PKD2L1 and PKD1L3. (a) In situ hybridization of PKD2L1 and PKD1L3 against circumvallate, foliate, fungiform and palate taste buds illustrating expression of PKD2L1 in subsets of TRCs of all taste buds, but a total lack of PKD1L3 in fungiform and palate TRCs. Approximately 20% of taste cells express PKD2L1. Dotted lines show the outline of sample taste buds. (b) PKD2L1 is not in sweet, umami and bitter cells. The first three panels show co-labeling with a PKD2L1 antisense RNA probe (PKD) and T1R3 (T1R, sweet and umami cells), a mixture of 20 T2Rs (bitter cells), and TRPM5 (sweet, umami and bitter cells), respectively. The last panel shows co-labeling with anti-PKD2L1 antibodies and an antisense PKD1L3 RNA probe. Note the absence of overlap between PKD2L1-expressing cells and those expressing sweet, umami or bitter receptors. However, PKD1L3 is always co-expressed with PKD2L1 in CV and foliate papillae.

[0313]FIG. 9: PKD2L1 and PKD1L3 are enriched in the taste pore. Immunofluorescent stainings of mouse taste buds with PKD2L1 (left panel) and with PKD1L3 (right panel) antibodies. The pictures show superposition of fluorescent antibody signals on DIC images of taste tissue. Dotted lines illustrate the outline of a taste bud, and arrows point to the taste pore region

[0314]FIG. 10: Loss of selective TRCs in DTA-expressing animals. Upper diagram illustrates the strategy used to target DTA or GFP to selective populations of TRCs. BAC constructs contained the entire T1R2 or PKD2L1 genes with the IRES-Cre added downstream of the termination codon, but upstream of polyA-addition signals. In both cases, the transgenic constructs included at least 50 Kb of flanking sequences upstream and downstream of the target gene (see Methods). Fidelity of Cre and reporter expression in the correct cell types was confirmed by double labeling with a variety of TRC-specific gene probes. Lower panels show in situ hybridization experiments examining the presence of sweet (T1Rs), bitter (T2Rs) or PKD2L1-expressing cells in the two engineered lines. Targeting of DTA to T1R2-- or PKD2L1-expressing cells eliminates over 95% of their respective TRC population. In situ hybridization probes were as in FIG. 8.

REFERENCES

[0315]1. Lindemann, B. Receptors and transduction in taste. Nature 413, 219-25 (2001). [0316]2. Kinnamon, S. C. & Margolskee, R. F. Mechanisms of taste transduction. Curr Opin Neurobiol 6, 506-13 (1996). [0317]3. DeSimone, J. A., Lyall, V., Heck, G. L. & Feldman, G. M. Acid detection by taste receptor cells. Respir Physiol 129, 23145 (2001). [0318]4. Wu, G. et al. Identification of PKD2L, a human PKD2-related gene: tissue-specific expression and mapping to chromosome 10q25. Genomics 54, 564-8 (1998). [0319]5. Adler, E. et al. A novel family of mammalian taste receptors. Cell 100, 693-702 (2000). [0320]6. Nelson, G. et al. Mammalian sweet taste receptors. Cell 106, 381-90 (2001). [0321]7. Nelson, G. et al. An amino-acid taste receptor. Nature 416, 199-202 (2002). [0322]8. Zhang, Y. et al. Coding of sweet, bitter, and umami tastes: different receptor cells sharing similar signaling pathways. Cell 112, 293-301 (2003). [0323]9. Zhao, G. Q. et al. The receptors for mammalian sweet and umami taste. Cell 115, 255-66 (2003). [0324]10. Mueller, K. L. et al. The receptors and coding logic for bitter taste. Nature 434, 225-9 (2005). [0325]11. Vigh, B. et al. The system of cerebrospinal fluid-contacting neurons. Its supposed role in the nonsynaptic signal transmission of the brain. Histol Histopathol 19, 607-28 (2004). [0326]12. Lyall, V. et al. The mammalian amiloride-insensitive non-specific salt taste receptor is a vanilloid receptor-1 variant. J Physiol 558, 147-59 (2004). [0327]13. Richter, T. A., Dvoryanchikov, G. A., Chaudhari, N. & Roper, S. D. Acid-sensitive two-pore domain potassium (K2P) channels in mouse taste buds. J Neurophysiol 92, 1928-36 (2004). [0328]14. Vinnikova, A. K. et al. Na+-H+ exchange activity in taste receptor cells. J Neurophysiol 91, 1297-313 (2004). [0329]15. Matsunami, H., Montmayeur, J. P. & Buck, L. B. A family of candidate taste receptors in human and mouse. Nature 404, 601-4 (2000). [0330]16. Chandrashekar, J. et al. T2Rs function as bitter taste receptors. Cell 100, 703-11 (2000). [0331]17. Li, X. et al. Human receptors for sweet and umami taste. Proc Natl Acad Sci USA 99, 4692-6 (2002). [0332]18. Nauli, S. M. et al. Polycystins 1 and 2 mediate mechanosensation in the primary cilium of kidney cells. Nat Genet 33, 129-37 (2003). [0333]19. Delmas, P. Polycystins: polymodal receptor/ion-channel cellular sensors. Pflugers Arch 451, 264-76 (2005). [0334]20. Clapham, D. E. TRP channels as cellular sensors. Nature 426, 517-24 (2003). [0335]21. Murakami, M. et al. Genomic organization and functional analysis of murine PKD2L1. J Biol Chem 280, 5626-35 (2005). [0336]22. Lopezjimenez, N. D. et al. Two members of the TRPP family of ion channels, Pkd1l3 and Pkd2l1, are co-expressed in a subset of taste receptor cells. J Neurochem 98, 68-77 (2006). [0337]23. Hoon, M. A. et al. Putative mammalian taste receptors: a class of taste-specific GPCRs with distinct topographic selectivity. Cell 96, 541-51 (1999). [0338]24. Collier, R. J. Diphtheria toxin: mode of action and structure. Bacteriol Rev 39, 54-85 (1975). [0339]25. Brockschnieder, D. et al. Cell depletion due to diphtheria toxin fragment A after Cre-mediated recombination. Mol Cell Biol 24, 7636-42 (2004). [0340]26. Novak, A., Guo, C., Yang, W., Nagy, A. & Lobe, C. G. Z/EG, a double reporter mouse line that expresses enhanced green fluorescent protein upon Cre-mediated excision. Genesis 28, 147-55 (2000). [0341]27. Perez, C. A. et al. A transient receptor potential channel expressed in taste receptor cells. Nat Neurosci 5, 1169-76 (2002). [0342]28. Lahiri, S. & Forster, R. E., 2nd. CO.sub.2/H(+) sensing: peripheral and central chemoreception. Int J Biochem Cell Biol 35, 1413-35 (2003). [0343]29. Richerson, G. B., Wang, W., Hodges, M. R., Dohle, C. I. & Diez-Sampedro, A. Homing in on the specific phenotype(s) of central respiratory chemoreceptors. Exp Physiol 90, 259-66; discussion 266-9 (2005). [0344]30. Gosgnach, S. et al. V1 spinal neurons regulate the speed of vertebrate locomotor outputs. Nature 440, 215-9 (2006). [0345]31. Cassill, J. A., Whitney, M., Joazeiro, C. A., Becker, A. & Zuker, C. [0346]S. Isolation of Drosophila genes encoding G protein-coupled receptor kinases. Proc Natl Acad Sci USA 88, 11067-70 (1991). [0347]32. Lee, E. C. et al. A highly efficient Escherichia coli-based chromosome engineering system adapted for recombinogenic targeting and subcloning of BAC DNA. Genomics 73, 56-65 (2001).

[0348]While the foregoing invention has been described in some detail for purposes of clarity and understanding, it will be clear to one skilled in the art from a reading of this disclosure that various changes in form and detail can be made without departing from the true scope of the invention. For example, all the techniques and apparatus described above can be used in various combinations. All publications, patents, patent applications, and/or other documents cited in this application are incorporated by reference in their entirety for all purposes to the same extent as if each individual publication, patent, patent application, and/or other document were individually and separately indicated to be incorporated by reference for all purposes.

* * * * *